BLASTX nr result
ID: Ophiopogon23_contig00023209
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00023209 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259180.1| histone-lysine N-methyltransferase, H3 lysin... 75 9e-13 ref|XP_020244405.1| histone-lysine N-methyltransferase, H3 lysin... 55 6e-06 >ref|XP_020259180.1| histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6-like [Asparagus officinalis] gb|ONK76564.1| uncharacterized protein A4U43_C03F29630 [Asparagus officinalis] Length = 1083 Score = 74.7 bits (182), Expect = 9e-13 Identities = 48/97 (49%), Positives = 57/97 (58%), Gaps = 3/97 (3%) Frame = +1 Query: 127 GHVEVEVLSSNKCRNGDEE---EKPSRWKGFPALKRRKVSGVRDFPVGCGRDASKIRNVS 297 GHVE E + + DEE E+ K F LKRRKVS VRDFP+GCGR +SK Sbjct: 169 GHVEDEEGMRHLKKRADEEDVKEEKLNAKRFVGLKRRKVSAVRDFPLGCGRASSK----- 223 Query: 298 NSEVGPITSSESNVFDGEKKVVDVEVRMNGGKAKDSI 408 NS GPI SSES + V D EVRMN +AK+S+ Sbjct: 224 NSNAGPIASSESESKSKSRAVNDDEVRMNVVEAKNSV 260 >ref|XP_020244405.1| histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6-like [Asparagus officinalis] gb|ONK59326.1| uncharacterized protein A4U43_C08F5290 [Asparagus officinalis] Length = 1032 Score = 55.1 bits (131), Expect = 6e-06 Identities = 41/91 (45%), Positives = 48/91 (52%), Gaps = 1/91 (1%) Frame = +1 Query: 133 VEVEVLSSNKCRNGDEEEKP-SRWKGFPALKRRKVSGVRDFPVGCGRDASKIRNVSNSEV 309 VE E S K NG ++ K F ALKRR S VRDFPVGCG +ASKI ++S Sbjct: 115 VEEEQCRSRKRVNGGVTKQDLGVAKRFSALKRRSASVVRDFPVGCGGNASKICKNASSRA 174 Query: 310 GPITSSESNVFDGEKKVVDVEVRMNGGKAKD 402 P+ S F G EVR+NG AKD Sbjct: 175 VPVAS-----FGG-------EVRVNGENAKD 193