BLASTX nr result
ID: Ophiopogon23_contig00023054
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00023054 (1048 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65419.1| uncharacterized protein A4U43_C07F36900 [Asparagu... 60 6e-08 ref|XP_020275483.1| zinc finger CCCH domain-containing protein 6... 60 6e-08 ref|XP_020275484.1| zinc finger CCCH domain-containing protein 6... 60 6e-08 >gb|ONK65419.1| uncharacterized protein A4U43_C07F36900 [Asparagus officinalis] Length = 905 Score = 59.7 bits (143), Expect(2) = 6e-08 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -2 Query: 459 LPHEVQNWAQPRQWCWYYHQGSCYHRENCKYLHE 358 LP + QNWAQPRQ C YYHQGSC++ E+CKYLH+ Sbjct: 873 LPRQ-QNWAQPRQLCRYYHQGSCFYGESCKYLHQ 905 Score = 26.9 bits (58), Expect(2) = 6e-08 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = -1 Query: 553 RSHFNDNHGRY 521 +SHFN+NHGRY Sbjct: 839 QSHFNNNHGRY 849 >ref|XP_020275483.1| zinc finger CCCH domain-containing protein 62-like isoform X1 [Asparagus officinalis] Length = 579 Score = 59.7 bits (143), Expect(2) = 6e-08 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -2 Query: 459 LPHEVQNWAQPRQWCWYYHQGSCYHRENCKYLHE 358 LP + QNWAQPRQ C YYHQGSC++ E+CKYLH+ Sbjct: 547 LPRQ-QNWAQPRQLCRYYHQGSCFYGESCKYLHQ 579 Score = 26.9 bits (58), Expect(2) = 6e-08 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = -1 Query: 553 RSHFNDNHGRY 521 +SHFN+NHGRY Sbjct: 513 QSHFNNNHGRY 523 >ref|XP_020275484.1| zinc finger CCCH domain-containing protein 62-like isoform X2 [Asparagus officinalis] Length = 501 Score = 59.7 bits (143), Expect(2) = 6e-08 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -2 Query: 459 LPHEVQNWAQPRQWCWYYHQGSCYHRENCKYLHE 358 LP + QNWAQPRQ C YYHQGSC++ E+CKYLH+ Sbjct: 469 LPRQ-QNWAQPRQLCRYYHQGSCFYGESCKYLHQ 501 Score = 26.9 bits (58), Expect(2) = 6e-08 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = -1 Query: 553 RSHFNDNHGRY 521 +SHFN+NHGRY Sbjct: 435 QSHFNNNHGRY 445