BLASTX nr result
ID: Ophiopogon23_contig00022474
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00022474 (366 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265851.1| uncharacterized protein LOC109841327 [Aspara... 69 5e-11 >ref|XP_020265851.1| uncharacterized protein LOC109841327 [Asparagus officinalis] gb|ONK70541.1| uncharacterized protein A4U43_C05F34780 [Asparagus officinalis] Length = 353 Score = 68.6 bits (166), Expect = 5e-11 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = -1 Query: 366 ERSRNCFSSCKGSPKSSGIQQIGRVSGFQRHFQGSQTNKHS 244 ERSRNCF SCK SPK S +QQIGRV G QRHFQGSQ N S Sbjct: 291 ERSRNCFGSCKESPKGSSVQQIGRVGGLQRHFQGSQYNNRS 331