BLASTX nr result
ID: Ophiopogon23_contig00022137
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00022137 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX79664.1| hypothetical protein L195_g035651 [Trifolium prat... 56 2e-06 gb|PNY17782.1| hypothetical protein L195_g014534, partial [Trifo... 53 3e-06 ref|XP_018814205.1| PREDICTED: uncharacterized protein LOC108986... 54 8e-06 >gb|PNX79664.1| hypothetical protein L195_g035651 [Trifolium pratense] Length = 536 Score = 55.8 bits (133), Expect = 2e-06 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 3/56 (5%) Frame = -2 Query: 159 SDGHGSPS---HPRLRPDFPTFTGKDVHGWLYRVEQLLDFYNIAEEQRVRMAALYI 1 + H SP+ PRL+ D P F G D HGW++++ Q D++ EE+R+ +A+ Y+ Sbjct: 37 ASSHSSPNFHNRPRLKLDVPRFNGTDTHGWIFKISQFFDYHQTPEEERITIASFYL 92 >gb|PNY17782.1| hypothetical protein L195_g014534, partial [Trifolium pratense] Length = 117 Score = 52.8 bits (125), Expect = 3e-06 Identities = 18/47 (38%), Positives = 31/47 (65%) Frame = -2 Query: 141 PSHPRLRPDFPTFTGKDVHGWLYRVEQLLDFYNIAEEQRVRMAALYI 1 P PRL+ D P F G+ HGW++++ Q ++N EE+R+ +A+ Y+ Sbjct: 65 PQPPRLKLDVPRFDGQQAHGWIFKISQFFTYHNTPEEERITVASFYL 111 >ref|XP_018814205.1| PREDICTED: uncharacterized protein LOC108986137 [Juglans regia] Length = 575 Score = 54.3 bits (129), Expect = 8e-06 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = -2 Query: 150 HGSPSHPR-LRPDFPTFTGKDVHGWLYRVEQLLDFYNIAEEQRVRMAALYI 1 H HPR +R DFPTF G D HGWLY+V Q F+N + +R+A+ ++ Sbjct: 79 HTGEIHPRAIRLDFPTFNGGDPHGWLYKVNQFFSFHNTLPQHHLRLASFHM 129