BLASTX nr result
ID: Ophiopogon23_contig00021300
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00021300 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKU83716.1| Granule-bound starch synthase 1, chloroplastic/am... 98 7e-22 dbj|BAI99383.1| putative granulebound starch synthase, partial [... 94 5e-21 ref|XP_020681818.1| granule-bound starch synthase 1b, chloroplas... 98 6e-21 gb|ABK41739.1| granule-bound starch synthase II, partial [Oryza ... 90 6e-21 gb|ACJ67327.1| granule-bound starch synthase II, partial [Oryza ... 90 9e-21 gb|ACJ67309.1| granule-bound starch synthase II, partial [Oryza ... 90 9e-21 ref|XP_020112542.1| granule-bound starch synthase 1, chloroplast... 97 1e-20 dbj|BAM16824.1| putative granule-bound starch synthase, partial ... 92 1e-20 dbj|BAM16823.1| putative granule-bound starch synthase, partial ... 92 1e-20 dbj|BAM16818.1| putative granule-bound starch synthase, partial ... 92 1e-20 dbj|BAM16817.1| putative granule-bound starch synthase, partial ... 92 1e-20 dbj|BAM16789.1| putative granule-bound starch synthase, partial ... 92 1e-20 dbj|BAM16788.1| putative granule-bound starch synthase, partial ... 92 1e-20 dbj|BAM16782.1| putative granule-bound starch synthase, partial ... 92 1e-20 dbj|BAM16774.1| putative granule-bound starch synthase, partial ... 92 1e-20 dbj|BAM16751.1| putative granule-bound starch synthase, partial ... 92 1e-20 dbj|BAM16738.1| putative granule-bound starch synthase, partial ... 92 1e-20 dbj|BAM16735.1| putative granule-bound starch synthase, partial ... 92 1e-20 dbj|BAM16729.1| putative granule-bound starch synthase, partial ... 92 1e-20 dbj|BAM16725.1| putative granule-bound starch synthase, partial ... 92 1e-20 >gb|PKU83716.1| Granule-bound starch synthase 1, chloroplastic/amyloplastic [Dendrobium catenatum] Length = 300 Score = 98.2 bits (243), Expect = 7e-22 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQLSHLIINL 288 HCYKRGVDRVFVDHPMFLEKVWG+TGGKIYGPVTGTDYQDNQ+ + +L Sbjct: 160 HCYKRGVDRVFVDHPMFLEKVWGKTGGKIYGPVTGTDYQDNQIRFSLFSL 209 >dbj|BAI99383.1| putative granulebound starch synthase, partial [Shorea kunstleri] dbj|BAI99385.1| putative granulebound starch synthase, partial [Shorea kunstleri] dbj|BAI99386.1| putative granulebound starch synthase, partial [Shorea kunstleri] dbj|BAI99387.1| putative granulebound starch synthase, partial [Shorea kunstleri] dbj|BAI99389.1| putative granulebound starch synthase, partial [Shorea kunstleri] dbj|BAI99390.1| putative granulebound starch synthase, partial [Shorea kunstleri] dbj|BAI99392.1| putative granulebound starch synthase, partial [Shorea kunstleri] dbj|BAI99394.1| putative granulebound starch synthase, partial [Shorea kunstleri] Length = 189 Score = 93.6 bits (231), Expect = 5e-21 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQL 309 HCYKRGVDRVF+DHPMFLEKVWG+TG KIYGP+TGTDY+DNQL Sbjct: 48 HCYKRGVDRVFIDHPMFLEKVWGKTGSKIYGPITGTDYEDNQL 90 >ref|XP_020681818.1| granule-bound starch synthase 1b, chloroplastic/amyloplastic [Dendrobium catenatum] Length = 614 Score = 98.2 bits (243), Expect = 6e-21 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQLSHLIINL 288 HCYKRGVDRVFVDHPMFLEKVWG+TGGKIYGPVTGTDYQDNQ+ + +L Sbjct: 160 HCYKRGVDRVFVDHPMFLEKVWGKTGGKIYGPVTGTDYQDNQIRFSLFSL 209 >gb|ABK41739.1| granule-bound starch synthase II, partial [Oryza officinalis] gb|ABK41740.1| granule-bound starch synthase II, partial [Oryza officinalis] gb|ABK41741.1| granule-bound starch synthase II, partial [Oryza officinalis] gb|ABK41742.1| granule-bound starch synthase II, partial [Oryza officinalis] gb|ABK41743.1| granule-bound starch synthase II, partial [Oryza officinalis] gb|ABK41744.1| granule-bound starch synthase II, partial [Oryza officinalis] gb|ABK41745.1| granule-bound starch synthase II, partial [Oryza officinalis] gb|ABK41746.1| granule-bound starch synthase II, partial [Oryza officinalis] gb|ABK41747.1| granule-bound starch synthase II, partial [Oryza officinalis] gb|ABK41748.1| granule-bound starch synthase II, partial [Oryza officinalis] gb|ABK41749.1| granule-bound starch synthase II, partial [Oryza officinalis] gb|ABK41750.1| granule-bound starch synthase II, partial [Oryza officinalis] gb|ABK41751.1| granule-bound starch synthase II, partial [Oryza eichingeri] gb|ABK41752.1| granule-bound starch synthase II, partial [Oryza eichingeri] gb|ABK41753.1| granule-bound starch synthase II, partial [Oryza eichingeri] gb|ABK41754.1| granule-bound starch synthase II, partial [Oryza eichingeri] gb|ABK41755.1| granule-bound starch synthase II, partial [Oryza eichingeri] gb|ABK41756.1| granule-bound starch synthase II, partial [Oryza eichingeri] gb|ABK41757.1| granule-bound starch synthase II, partial [Oryza eichingeri] gb|ABK41758.1| granule-bound starch synthase II, partial [Oryza eichingeri] gb|ABK41759.1| granule-bound starch synthase II, partial [Oryza eichingeri] gb|ABK41760.1| granule-bound starch synthase II, partial [Oryza rhizomatis] gb|ABK41761.1| granule-bound starch synthase II, partial [Oryza rhizomatis] gb|ABK41762.1| granule-bound starch synthase II, partial [Oryza rhizomatis] gb|ABK41763.1| granule-bound starch synthase II, partial [Oryza rhizomatis] gb|ABK41764.1| granule-bound starch synthase II, partial [Oryza rhizomatis] gb|ABK41765.1| granule-bound starch synthase II, partial [Oryza rhizomatis] gb|ABK41766.1| granule-bound starch synthase II, partial [Oryza punctata] gb|ABK41767.1| granule-bound starch synthase II, partial [Oryza punctata] Length = 78 Score = 90.1 bits (222), Expect = 6e-21 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQLSHLIINL 288 HCYKRGVDRVFVDHPMFLEKVWG+TG K+YGP TG DY+DNQL ++ L Sbjct: 4 HCYKRGVDRVFVDHPMFLEKVWGKTGAKLYGPTTGDDYRDNQLRFCLLCL 53 >gb|ACJ67327.1| granule-bound starch synthase II, partial [Oryza latifolia] Length = 94 Score = 90.1 bits (222), Expect = 9e-21 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQLSHLIINL 288 HCYKRGVDRVFVDHPMFLEKVWG+TG K+YGP TG DY+DNQL ++ L Sbjct: 10 HCYKRGVDRVFVDHPMFLEKVWGKTGAKLYGPTTGDDYRDNQLRFCLLCL 59 >gb|ACJ67309.1| granule-bound starch synthase II, partial [Oryza grandiglumis] gb|ACJ67310.1| granule-bound starch synthase II, partial [Oryza grandiglumis] gb|ACJ67311.1| granule-bound starch synthase II, partial [Oryza grandiglumis] gb|ACJ67312.1| granule-bound starch synthase II, partial [Oryza grandiglumis] gb|ACJ67313.1| granule-bound starch synthase II, partial [Oryza latifolia] gb|ACJ67314.1| granule-bound starch synthase II, partial [Oryza latifolia] gb|ACJ67315.1| granule-bound starch synthase II, partial [Oryza latifolia] gb|ACJ67316.1| granule-bound starch synthase II, partial [Oryza latifolia] gb|ACJ67317.1| granule-bound starch synthase II, partial [Oryza latifolia] gb|ACJ67318.1| granule-bound starch synthase II, partial [Oryza latifolia] gb|ACJ67319.1| granule-bound starch synthase II, partial [Oryza latifolia] gb|ACJ67320.1| granule-bound starch synthase II, partial [Oryza grandiglumis] gb|ACJ67321.1| granule-bound starch synthase II, partial [Oryza grandiglumis] gb|ACJ67322.1| granule-bound starch synthase II, partial [Oryza grandiglumis] gb|ACJ67323.1| granule-bound starch synthase II, partial [Oryza grandiglumis] gb|ACJ67324.1| granule-bound starch synthase II, partial [Oryza latifolia] gb|ACJ67325.1| granule-bound starch synthase II, partial [Oryza latifolia] gb|ACJ67326.1| granule-bound starch synthase II, partial [Oryza latifolia] gb|ACJ67328.1| granule-bound starch synthase II, partial [Oryza latifolia] gb|ACJ67329.1| granule-bound starch synthase II, partial [Oryza latifolia] gb|ACJ67410.1| granule-bound starch synthase II, partial [Oryza alta] gb|ACJ67411.1| granule-bound starch synthase II, partial [Oryza alta] gb|ACJ67412.1| granule-bound starch synthase II, partial [Oryza alta] gb|ACJ67413.1| granule-bound starch synthase II, partial [Oryza alta] gb|ACJ67414.1| granule-bound starch synthase II, partial [Oryza alta] gb|ACJ67417.1| granule-bound starch synthase II, partial [Oryza alta] Length = 94 Score = 90.1 bits (222), Expect = 9e-21 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQLSHLIINL 288 HCYKRGVDRVFVDHPMFLEKVWG+TG K+YGP TG DY+DNQL ++ L Sbjct: 10 HCYKRGVDRVFVDHPMFLEKVWGKTGAKLYGPTTGDDYRDNQLRFCLLCL 59 >ref|XP_020112542.1| granule-bound starch synthase 1, chloroplastic/amyloplastic-like [Ananas comosus] Length = 730 Score = 97.4 bits (241), Expect = 1e-20 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQLSHLIINL 288 HCYKRGVDRVFVDHPMFLEKVWG+TGGKIYGP TGTDY+DNQL L++ L Sbjct: 275 HCYKRGVDRVFVDHPMFLEKVWGKTGGKIYGPTTGTDYEDNQLRFLLMCL 324 >dbj|BAM16824.1| putative granule-bound starch synthase, partial [Shorea maxwelliana] Length = 182 Score = 92.4 bits (228), Expect = 1e-20 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQL 309 HCYKRGVDRVF+DHPMFLEKVWG+TG KIYGP TGTDY+DNQL Sbjct: 41 HCYKRGVDRVFIDHPMFLEKVWGKTGSKIYGPTTGTDYEDNQL 83 >dbj|BAM16823.1| putative granule-bound starch synthase, partial [Shorea maxwelliana] Length = 182 Score = 92.4 bits (228), Expect = 1e-20 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQL 309 HCYKRGVDRVF+DHPMFLEKVWG+TG KIYGP TGTDY+DNQL Sbjct: 41 HCYKRGVDRVFIDHPMFLEKVWGKTGSKIYGPTTGTDYEDNQL 83 >dbj|BAM16818.1| putative granule-bound starch synthase, partial [Shorea acuminata] Length = 182 Score = 92.4 bits (228), Expect = 1e-20 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQL 309 HCYKRGVDRVF+DHPMFLEKVWG+TG KIYGP TGTDY+DNQL Sbjct: 41 HCYKRGVDRVFIDHPMFLEKVWGKTGSKIYGPTTGTDYEDNQL 83 >dbj|BAM16817.1| putative granule-bound starch synthase, partial [Shorea acuminata] Length = 182 Score = 92.4 bits (228), Expect = 1e-20 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQL 309 HCYKRGVDRVF+DHPMFLEKVWG+TG KIYGP TGTDY+DNQL Sbjct: 41 HCYKRGVDRVFIDHPMFLEKVWGKTGSKIYGPATGTDYEDNQL 83 >dbj|BAM16789.1| putative granule-bound starch synthase, partial [Shorea parvifolia] Length = 182 Score = 92.4 bits (228), Expect = 1e-20 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQL 309 HCYKRGVDRVF+DHPMFLEKVWG+TG KIYGP TGTDY+DNQL Sbjct: 41 HCYKRGVDRVFIDHPMFLEKVWGKTGSKIYGPTTGTDYEDNQL 83 >dbj|BAM16788.1| putative granule-bound starch synthase, partial [Shorea parvifolia] Length = 182 Score = 92.4 bits (228), Expect = 1e-20 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQL 309 HCYKRGVDRVF+DHPMFLEKVWG+TG KIYGP TGTDY+DNQL Sbjct: 41 HCYKRGVDRVFIDHPMFLEKVWGKTGSKIYGPTTGTDYEDNQL 83 >dbj|BAM16782.1| putative granule-bound starch synthase, partial [Shorea parvifolia] Length = 182 Score = 92.4 bits (228), Expect = 1e-20 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQL 309 HCYKRGVDRVF+DHPMFLEKVWG+TG KIYGP TGTDY+DNQL Sbjct: 41 HCYKRGVDRVFIDHPMFLEKVWGKTGSKIYGPTTGTDYEDNQL 83 >dbj|BAM16774.1| putative granule-bound starch synthase, partial [Shorea parvifolia] Length = 182 Score = 92.4 bits (228), Expect = 1e-20 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQL 309 HCYKRGVDRVF+DHPMFLEKVWG+TG KIYGP TGTDY+DNQL Sbjct: 41 HCYKRGVDRVFIDHPMFLEKVWGKTGSKIYGPTTGTDYEDNQL 83 >dbj|BAM16751.1| putative granule-bound starch synthase, partial [Shorea parvifolia] dbj|BAM16759.1| putative granule-bound starch synthase, partial [Shorea parvifolia] Length = 182 Score = 92.4 bits (228), Expect = 1e-20 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQL 309 HCYKRGVDRVF+DHPMFLEKVWG+TG KIYGP TGTDY+DNQL Sbjct: 41 HCYKRGVDRVFIDHPMFLEKVWGKTGSKIYGPTTGTDYEDNQL 83 >dbj|BAM16738.1| putative granule-bound starch synthase, partial [Shorea parvifolia] Length = 182 Score = 92.4 bits (228), Expect = 1e-20 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQL 309 HCYKRGVDRVF+DHPMFLEKVWG+TG KIYGP TGTDY+DNQL Sbjct: 41 HCYKRGVDRVFIDHPMFLEKVWGKTGSKIYGPTTGTDYEDNQL 83 >dbj|BAM16735.1| putative granule-bound starch synthase, partial [Shorea parvifolia] dbj|BAM16736.1| putative granule-bound starch synthase, partial [Shorea parvifolia] Length = 182 Score = 92.4 bits (228), Expect = 1e-20 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQL 309 HCYKRGVDRVF+DHPMFLEKVWG+TG KIYGP TGTDY+DNQL Sbjct: 41 HCYKRGVDRVFIDHPMFLEKVWGKTGSKIYGPTTGTDYEDNQL 83 >dbj|BAM16729.1| putative granule-bound starch synthase, partial [Shorea parvifolia] Length = 182 Score = 92.4 bits (228), Expect = 1e-20 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQL 309 HCYKRGVDRVF+DHPMFLEKVWG+TG KIYGP TGTDY+DNQL Sbjct: 41 HCYKRGVDRVFIDHPMFLEKVWGKTGSKIYGPTTGTDYEDNQL 83 >dbj|BAM16725.1| putative granule-bound starch synthase, partial [Shorea parvifolia] Length = 182 Score = 92.4 bits (228), Expect = 1e-20 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 437 HCYKRGVDRVFVDHPMFLEKVWGETGGKIYGPVTGTDYQDNQL 309 HCYKRGVDRVF+DHPMFLEKVWG+TG KIYGP TGTDY+DNQL Sbjct: 41 HCYKRGVDRVFIDHPMFLEKVWGKTGSKIYGPTTGTDYEDNQL 83