BLASTX nr result
ID: Ophiopogon23_contig00021099
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00021099 (1532 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245076.1| LOW QUALITY PROTEIN: uncharacterized protein... 74 5e-10 gb|ONK82052.1| uncharacterized protein A4U43_C01F35630 [Asparagu... 74 5e-10 >ref|XP_020245076.1| LOW QUALITY PROTEIN: uncharacterized protein LOC109823175 [Asparagus officinalis] Length = 951 Score = 73.9 bits (180), Expect = 5e-10 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = +2 Query: 1328 KTLQAKLLQSERMEEG*LEIDNSNPRLLYVNTPSATFSWTTSEEMDT 1468 KT QAKLLQSE++ EG LEID NPR LY+N P+ATFSWTTSEE+DT Sbjct: 278 KTFQAKLLQSEKVAEGSLEIDAGNPRPLYINRPTATFSWTTSEEIDT 324 >gb|ONK82052.1| uncharacterized protein A4U43_C01F35630 [Asparagus officinalis] Length = 959 Score = 73.9 bits (180), Expect = 5e-10 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = +2 Query: 1328 KTLQAKLLQSERMEEG*LEIDNSNPRLLYVNTPSATFSWTTSEEMDT 1468 KT QAKLLQSE++ EG LEID NPR LY+N P+ATFSWTTSEE+DT Sbjct: 311 KTFQAKLLQSEKVAEGSLEIDAGNPRPLYINRPTATFSWTTSEEIDT 357