BLASTX nr result
ID: Ophiopogon23_contig00020643
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00020643 (565 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIU49779.1| uncoupling protein 3, partial [Musa acuminata] 75 1e-13 gb|AIU49792.1| uncoupling protein 3, partial [Iris japonica] 76 4e-13 ref|XP_020580865.1| mitochondrial uncoupling protein 3 [Phalaeno... 76 4e-13 gb|PIN13284.1| hypothetical protein CDL12_14090 [Handroanthus im... 74 5e-13 ref|XP_018850439.1| PREDICTED: mitochondrial uncoupling protein ... 76 5e-13 gb|EMS59957.1| hypothetical protein TRIUR3_07454 [Triticum urartu] 73 6e-13 gb|AIU49780.1| uncoupling protein 3, partial [Pinellia ternata] 75 7e-13 gb|AIU49796.1| uncoupling protein 3, partial [Asparagus officina... 75 8e-13 gb|PHT62354.1| Mitochondrial uncoupling protein 3, partial [Caps... 74 9e-13 ref|XP_020270305.1| mitochondrial uncoupling protein 3 [Asparagu... 75 9e-13 emb|CDP00364.1| unnamed protein product [Coffea canephora] 75 9e-13 dbj|BAG97477.1| unnamed protein product [Oryza sativa Japonica G... 73 9e-13 gb|ONK67258.1| uncharacterized protein A4U43_C06F18270 [Asparagu... 75 1e-12 ref|XP_019165923.1| PREDICTED: mitochondrial uncoupling protein ... 75 1e-12 ref|XP_009406633.1| PREDICTED: mitochondrial uncoupling protein ... 75 1e-12 ref|XP_023893630.1| mitochondrial uncoupling protein 3 [Quercus ... 75 1e-12 gb|KMT07016.1| hypothetical protein BVRB_6g153480 isoform A [Bet... 72 1e-12 ref|XP_018622499.1| PREDICTED: mitochondrial uncoupling protein ... 74 1e-12 ref|XP_015895050.1| PREDICTED: mitochondrial uncoupling protein ... 75 2e-12 ref|XP_010527931.1| PREDICTED: mitochondrial uncoupling protein ... 74 2e-12 >gb|AIU49779.1| uncoupling protein 3, partial [Musa acuminata] Length = 167 Score = 75.1 bits (183), Expect = 1e-13 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEKLR+VSG Sbjct: 132 ALWKGFFPTWARLGPWQFVFWVSYEKLRRVSG 163 >gb|AIU49792.1| uncoupling protein 3, partial [Iris japonica] Length = 293 Score = 76.3 bits (186), Expect = 4e-13 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEKLRQ+SG Sbjct: 258 ALWKGFFPTWARLGPWQFVFWVSYEKLRQISG 289 >ref|XP_020580865.1| mitochondrial uncoupling protein 3 [Phalaenopsis equestris] ref|XP_020580867.1| mitochondrial uncoupling protein 3 [Phalaenopsis equestris] ref|XP_020580868.1| mitochondrial uncoupling protein 3 [Phalaenopsis equestris] ref|XP_020580869.1| mitochondrial uncoupling protein 3 [Phalaenopsis equestris] Length = 305 Score = 76.3 bits (186), Expect = 4e-13 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEKLRQ+SG Sbjct: 270 ALWKGFFPTWARLGPWQFVFWVSYEKLRQISG 301 >gb|PIN13284.1| hypothetical protein CDL12_14090 [Handroanthus impetiginosus] Length = 168 Score = 73.6 bits (179), Expect = 5e-13 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEK RQ++G Sbjct: 133 ALWKGFFPTWARLGPWQFVFWVSYEKFRQIAG 164 >ref|XP_018850439.1| PREDICTED: mitochondrial uncoupling protein 3 [Juglans regia] Length = 334 Score = 76.3 bits (186), Expect = 5e-13 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEKLRQ+SG Sbjct: 299 ALWKGFFPTWARLGPWQFVFWVSYEKLRQISG 330 >gb|EMS59957.1| hypothetical protein TRIUR3_07454 [Triticum urartu] Length = 144 Score = 72.8 bits (177), Expect = 6e-13 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGF PTWARLGPWQFVFWVSYEKLRQ SG Sbjct: 81 ALWKGFLPTWARLGPWQFVFWVSYEKLRQASG 112 >gb|AIU49780.1| uncoupling protein 3, partial [Pinellia ternata] Length = 294 Score = 75.5 bits (184), Expect = 7e-13 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEKLRQV+G Sbjct: 259 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVAG 290 >gb|AIU49796.1| uncoupling protein 3, partial [Asparagus officinalis] Length = 282 Score = 75.1 bits (183), Expect = 8e-13 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEK RQVSG Sbjct: 247 ALWKGFFPTWARLGPWQFVFWVSYEKFRQVSG 278 >gb|PHT62354.1| Mitochondrial uncoupling protein 3, partial [Capsicum annuum] Length = 196 Score = 73.6 bits (179), Expect = 9e-13 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEK RQ++G Sbjct: 161 ALWKGFFPTWARLGPWQFVFWVSYEKFRQIAG 192 >ref|XP_020270305.1| mitochondrial uncoupling protein 3 [Asparagus officinalis] Length = 288 Score = 75.1 bits (183), Expect = 9e-13 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEK RQVSG Sbjct: 253 ALWKGFFPTWARLGPWQFVFWVSYEKFRQVSG 284 >emb|CDP00364.1| unnamed protein product [Coffea canephora] Length = 289 Score = 75.1 bits (183), Expect = 9e-13 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEKLRQ++G Sbjct: 254 ALWKGFFPTWARLGPWQFVFWVSYEKLRQIAG 285 >dbj|BAG97477.1| unnamed protein product [Oryza sativa Japonica Group] Length = 166 Score = 72.8 bits (177), Expect = 9e-13 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGF PTWARLGPWQFVFWVSYEKLRQ SG Sbjct: 131 ALWKGFLPTWARLGPWQFVFWVSYEKLRQASG 162 >gb|ONK67258.1| uncharacterized protein A4U43_C06F18270 [Asparagus officinalis] Length = 299 Score = 75.1 bits (183), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEK RQVSG Sbjct: 264 ALWKGFFPTWARLGPWQFVFWVSYEKFRQVSG 295 >ref|XP_019165923.1| PREDICTED: mitochondrial uncoupling protein 3 [Ipomoea nil] Length = 306 Score = 75.1 bits (183), Expect = 1e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEKLRQ++G Sbjct: 271 ALWKGFFPTWARLGPWQFVFWVSYEKLRQIAG 302 >ref|XP_009406633.1| PREDICTED: mitochondrial uncoupling protein 3 [Musa acuminata subsp. malaccensis] Length = 310 Score = 75.1 bits (183), Expect = 1e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEKLR+VSG Sbjct: 275 ALWKGFFPTWARLGPWQFVFWVSYEKLRRVSG 306 >ref|XP_023893630.1| mitochondrial uncoupling protein 3 [Quercus suber] gb|POE59548.1| mitochondrial uncoupling protein 3 [Quercus suber] Length = 313 Score = 75.1 bits (183), Expect = 1e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEKLRQ++G Sbjct: 278 ALWKGFFPTWARLGPWQFVFWVSYEKLRQIAG 309 >gb|KMT07016.1| hypothetical protein BVRB_6g153480 isoform A [Beta vulgaris subsp. vulgaris] Length = 168 Score = 72.4 bits (176), Expect = 1e-12 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQF+FWVSYEK RQ++G Sbjct: 133 ALWKGFFPTWARLGPWQFMFWVSYEKFRQIAG 164 >ref|XP_018622499.1| PREDICTED: mitochondrial uncoupling protein 3 [Nicotiana tomentosiformis] Length = 224 Score = 73.6 bits (179), Expect = 1e-12 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEK RQ++G Sbjct: 51 ALWKGFFPTWARLGPWQFVFWVSYEKFRQIAG 82 Score = 71.2 bits (173), Expect = 1e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVS 93 ALWKGFFPTWARLGPWQFVFWVSYEK RQ++ Sbjct: 130 ALWKGFFPTWARLGPWQFVFWVSYEKFRQIA 160 >ref|XP_015895050.1| PREDICTED: mitochondrial uncoupling protein 3 [Ziziphus jujuba] Length = 360 Score = 75.1 bits (183), Expect = 2e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEKLRQ++G Sbjct: 325 ALWKGFFPTWARLGPWQFVFWVSYEKLRQIAG 356 >ref|XP_010527931.1| PREDICTED: mitochondrial uncoupling protein 3 [Tarenaya hassleriana] Length = 293 Score = 74.3 bits (181), Expect = 2e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 ALWKGFFPTWARLGPWQFVFWVSYEKLRQVSG 96 ALWKGFFPTWARLGPWQFVFWVSYEKLRQ++G Sbjct: 258 ALWKGFFPTWARLGPWQFVFWVSYEKLRQLAG 289