BLASTX nr result
ID: Ophiopogon23_contig00020284
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00020284 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254332.1| thioredoxin X, chloroplastic, partial [Aspar... 55 1e-06 >ref|XP_020254332.1| thioredoxin X, chloroplastic, partial [Asparagus officinalis] Length = 162 Score = 55.1 bits (131), Expect = 1e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 338 EY*DKFKIMKIDHDANPLLIEEYKVCGLPC 427 EY DK KI+KIDHDANP LIEEYKV GLPC Sbjct: 95 EYKDKLKIVKIDHDANPQLIEEYKVYGLPC 124