BLASTX nr result
ID: Ophiopogon23_contig00020069
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00020069 (476 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020274440.1| microfibrillar-associated protein 1-like [As... 87 1e-22 ref|XP_019701615.1| PREDICTED: microfibrillar-associated protein... 82 1e-21 gb|OVA06120.1| Micro-fibrillar-associated protein 1 [Macleaya co... 83 1e-21 ref|XP_020680183.1| microfibrillar-associated protein 1-like [De... 84 2e-21 gb|KMZ60036.1| Microfibrillar-associated protein 1 [Zostera marina] 80 2e-21 gb|OVA11556.1| Micro-fibrillar-associated protein 1 [Macleaya co... 82 2e-21 emb|CAN78798.1| hypothetical protein VITISV_035471 [Vitis vinifera] 83 2e-21 ref|XP_010670028.1| PREDICTED: microfibrillar-associated protein... 81 2e-21 ref|XP_010275284.1| PREDICTED: microfibrillar-associated protein... 83 2e-21 ref|XP_008442034.1| PREDICTED: microfibrillar-associated protein... 83 2e-21 ref|XP_011653945.1| PREDICTED: microfibrillar-associated protein... 83 2e-21 ref|XP_008679400.1| microfibrillar-associated protein 1 [Zea may... 83 2e-21 ref|XP_010260413.1| PREDICTED: microfibrillar-associated protein... 83 2e-21 gb|PKA64627.1| hypothetical protein AXF42_Ash007374 [Apostasia s... 81 3e-21 ref|XP_022154515.1| microfibrillar-associated protein 1 [Momordi... 83 3e-21 ref|XP_021317209.1| microfibrillar-associated protein 1-like [So... 84 3e-21 ref|XP_022742384.1| microfibrillar-associated protein 1-like [Du... 83 4e-21 gb|PAN11213.1| hypothetical protein PAHAL_B03196 [Panicum hallii] 84 4e-21 ref|XP_023766377.1| microfibrillar-associated protein 1-like [La... 82 5e-21 ref|XP_019188672.1| PREDICTED: microfibrillar-associated protein... 80 5e-21 >ref|XP_020274440.1| microfibrillar-associated protein 1-like [Asparagus officinalis] ref|XP_020274441.1| microfibrillar-associated protein 1-like [Asparagus officinalis] gb|ONK65053.1| uncharacterized protein A4U43_C07F33020 [Asparagus officinalis] Length = 433 Score = 87.4 bits (215), Expect(2) = 1e-22 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWA+DA Sbjct: 1 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWADDA 42 Score = 46.6 bits (109), Expect(2) = 1e-22 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEE 93 AE + E+KEEIR HRRIRQAEIV TIEEE Sbjct: 80 AENKSENKEEIRADHRRIRQAEIVTTIEEE 109 >ref|XP_019701615.1| PREDICTED: microfibrillar-associated protein 1 [Elaeis guineensis] ref|XP_019701616.1| PREDICTED: microfibrillar-associated protein 1 [Elaeis guineensis] Length = 431 Score = 82.4 bits (202), Expect(2) = 1e-21 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAG+S+AAIAVRDKLRGKIGQTKVKRYWPGK PEWA++A Sbjct: 1 MSVTAGISDAAIAVRDKLRGKIGQTKVKRYWPGKPPEWADEA 42 Score = 48.1 bits (113), Expect(2) = 1e-21 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEE 93 AE R E+KEE+R HRRIRQAEIV+TIEEE Sbjct: 80 AENRVENKEEVRADHRRIRQAEIVSTIEEE 109 >gb|OVA06120.1| Micro-fibrillar-associated protein 1 [Macleaya cordata] Length = 396 Score = 82.8 bits (203), Expect(2) = 1e-21 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAGVS+ IA+RDKLRGKIGQTKVKRYWPGKAPEWA+DA Sbjct: 1 MSVTAGVSDTVIAIRDKLRGKIGQTKVKRYWPGKAPEWADDA 42 Score = 47.8 bits (112), Expect(2) = 1e-21 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEEN 90 AE + +++EEIR HRRIRQAEIV+TIEEEN Sbjct: 80 AESKIDNREEIRADHRRIRQAEIVSTIEEEN 110 >ref|XP_020680183.1| microfibrillar-associated protein 1-like [Dendrobium catenatum] gb|PKU80011.1| hypothetical protein MA16_Dca014376 [Dendrobium catenatum] Length = 437 Score = 84.0 bits (206), Expect(2) = 2e-21 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAGVS+A IA+RDKLRGKIGQTKVKRYWPGKAPEWAE+A Sbjct: 1 MSVTAGVSDAVIAIRDKLRGKIGQTKVKRYWPGKAPEWAEEA 42 Score = 46.2 bits (108), Expect(2) = 2e-21 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEEN 90 AE R E+KEE+R HRRIRQAEI++TIEEE+ Sbjct: 82 AELRAENKEEVRADHRRIRQAEIISTIEEES 112 >gb|KMZ60036.1| Microfibrillar-associated protein 1 [Zostera marina] Length = 435 Score = 80.1 bits (196), Expect(2) = 2e-21 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAED 236 MSVTAGVS+A IA+R+KL+GKIGQTKVKRYWPGKAPEWA+D Sbjct: 1 MSVTAGVSDAVIAIREKLKGKIGQTKVKRYWPGKAPEWADD 41 Score = 50.1 bits (118), Expect(2) = 2e-21 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEEN 90 AE R E+KEE+R HRRIRQAEIV+TIEEEN Sbjct: 81 AENRTENKEEVRADHRRIRQAEIVSTIEEEN 111 >gb|OVA11556.1| Micro-fibrillar-associated protein 1 [Macleaya cordata] Length = 433 Score = 82.4 bits (202), Expect(2) = 2e-21 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAGVS+ IA+RDKLRGKIGQTKVKRYWPGKAPEWA+DA Sbjct: 1 MSVTAGVSDTIIAIRDKLRGKIGQTKVKRYWPGKAPEWADDA 42 Score = 47.8 bits (112), Expect(2) = 2e-21 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEEN 90 AE + +++EEIR HRRIRQAEIV+TIEEEN Sbjct: 80 AESKIDNREEIRADHRRIRQAEIVSTIEEEN 110 >emb|CAN78798.1| hypothetical protein VITISV_035471 [Vitis vinifera] Length = 414 Score = 82.8 bits (203), Expect(2) = 2e-21 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAGVS+ IA+RDKLRGKIGQTKVKRYWPGKAPEWA+DA Sbjct: 1 MSVTAGVSDTVIAIRDKLRGKIGQTKVKRYWPGKAPEWADDA 42 Score = 47.4 bits (111), Expect(2) = 2e-21 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEEN 90 AE R ++++E+R HRRIRQAEIV+TIEEEN Sbjct: 83 AESRIDNRDEVRADHRRIRQAEIVSTIEEEN 113 >ref|XP_010670028.1| PREDICTED: microfibrillar-associated protein 1 [Beta vulgaris subsp. vulgaris] gb|KMT17395.1| hypothetical protein BVRB_2g038490 [Beta vulgaris subsp. vulgaris] Length = 438 Score = 80.9 bits (198), Expect(2) = 2e-21 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAGVS+A IA+R+KLRGKIGQTKVKRYWPGKAPEWA++A Sbjct: 1 MSVTAGVSDAIIAIREKLRGKIGQTKVKRYWPGKAPEWADEA 42 Score = 48.9 bits (115), Expect(2) = 2e-21 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEEN 90 AE R E++EEIR HRRIRQAEIV+T+EEEN Sbjct: 81 AENRAENREEIRADHRRIRQAEIVSTVEEEN 111 >ref|XP_010275284.1| PREDICTED: microfibrillar-associated protein 1-like [Nelumbo nucifera] Length = 434 Score = 82.8 bits (203), Expect(2) = 2e-21 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAGVS+ IA+RDKLRGKIGQTKVKRYWPGKAPEWA+DA Sbjct: 1 MSVTAGVSDTVIAIRDKLRGKIGQTKVKRYWPGKAPEWADDA 42 Score = 47.0 bits (110), Expect(2) = 2e-21 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEEN 90 AE R +++EEIR HRRIRQAEIV+TIEEE+ Sbjct: 81 AESRIDNREEIRADHRRIRQAEIVSTIEEES 111 >ref|XP_008442034.1| PREDICTED: microfibrillar-associated protein 1 [Cucumis melo] ref|XP_008442035.1| PREDICTED: microfibrillar-associated protein 1 [Cucumis melo] Length = 433 Score = 83.2 bits (204), Expect(2) = 2e-21 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAGVS+ IAVRDKLRGKIGQTKVKRYWPGKAPEWA+DA Sbjct: 1 MSVTAGVSDTVIAVRDKLRGKIGQTKVKRYWPGKAPEWADDA 42 Score = 46.6 bits (109), Expect(2) = 2e-21 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEE 93 AE R +++EEIR HRRIRQAEIV+TIEEE Sbjct: 80 AESRIDNREEIRADHRRIRQAEIVSTIEEE 109 >ref|XP_011653945.1| PREDICTED: microfibrillar-associated protein 1 [Cucumis sativus] gb|KGN54899.1| hypothetical protein Csa_4G578870 [Cucumis sativus] Length = 433 Score = 83.2 bits (204), Expect(2) = 2e-21 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAGVS+ IAVRDKLRGKIGQTKVKRYWPGKAPEWA+DA Sbjct: 1 MSVTAGVSDTVIAVRDKLRGKIGQTKVKRYWPGKAPEWADDA 42 Score = 46.6 bits (109), Expect(2) = 2e-21 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEE 93 AE R +++EEIR HRRIRQAEIV+TIEEE Sbjct: 80 AESRIDNREEIRADHRRIRQAEIVSTIEEE 109 >ref|XP_008679400.1| microfibrillar-associated protein 1 [Zea mays] gb|AQK57340.1| microfibrillar-associated protein-related [Zea mays] Length = 430 Score = 82.8 bits (203), Expect(2) = 2e-21 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAED 236 MSV AGVS+AAIAVRDKLRGKIGQTKVKRYWPGKAPEWA+D Sbjct: 1 MSVAAGVSDAAIAVRDKLRGKIGQTKVKRYWPGKAPEWADD 41 Score = 47.0 bits (110), Expect(2) = 2e-21 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEEN 90 AE R E+KEE+R HRRIRQAEIV+T EEEN Sbjct: 79 AETRAENKEELRADHRRIRQAEIVSTAEEEN 109 >ref|XP_010260413.1| PREDICTED: microfibrillar-associated protein 1-like [Nelumbo nucifera] ref|XP_010260414.1| PREDICTED: microfibrillar-associated protein 1-like [Nelumbo nucifera] Length = 428 Score = 82.8 bits (203), Expect(2) = 2e-21 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAGVS+ IA+RDKLRGKIGQTKVKRYWPGKAPEWA+DA Sbjct: 1 MSVTAGVSDTVIAIRDKLRGKIGQTKVKRYWPGKAPEWADDA 42 Score = 47.0 bits (110), Expect(2) = 2e-21 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEEN 90 AE R +++EEIR HRRIRQAEIV+TIEEE+ Sbjct: 81 AESRIDNREEIRADHRRIRQAEIVSTIEEES 111 >gb|PKA64627.1| hypothetical protein AXF42_Ash007374 [Apostasia shenzhenica] Length = 436 Score = 81.3 bits (199), Expect(2) = 3e-21 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAGVS+A I +RDKLRGKIGQTKVKRYWPGKAPEWA++A Sbjct: 1 MSVTAGVSDAVITIRDKLRGKIGQTKVKRYWPGKAPEWADEA 42 Score = 48.1 bits (113), Expect(2) = 3e-21 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEEN 90 AE R E+KEE+R HRRIRQAEI++TIEEEN Sbjct: 82 AELRSENKEEVRADHRRIRQAEIISTIEEEN 112 >ref|XP_022154515.1| microfibrillar-associated protein 1 [Momordica charantia] Length = 433 Score = 83.2 bits (204), Expect(2) = 3e-21 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAGVS+ IAVRDKLRGKIGQTKVKRYWPGKAPEWA+DA Sbjct: 1 MSVTAGVSDTVIAVRDKLRGKIGQTKVKRYWPGKAPEWADDA 42 Score = 46.2 bits (108), Expect(2) = 3e-21 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEE 93 AE R +++EE+R HRRIRQAEIV+TIEEE Sbjct: 80 AESRIDNREEVRADHRRIRQAEIVSTIEEE 109 >ref|XP_021317209.1| microfibrillar-associated protein 1-like [Sorghum bicolor] gb|KXG27719.1| hypothetical protein SORBI_3005G033300 [Sorghum bicolor] gb|KXG27720.1| hypothetical protein SORBI_3005G033300 [Sorghum bicolor] Length = 429 Score = 84.3 bits (207), Expect(2) = 3e-21 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSV AGVS+AAIAVRDKLRGKIGQTKVKRYWPGKAPEWA+DA Sbjct: 1 MSVAAGVSDAAIAVRDKLRGKIGQTKVKRYWPGKAPEWADDA 42 Score = 45.1 bits (105), Expect(2) = 3e-21 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEEN 90 AE R E+KEE+R HRRIRQAEIV+T EEE+ Sbjct: 77 AETRAENKEELRADHRRIRQAEIVSTAEEES 107 >ref|XP_022742384.1| microfibrillar-associated protein 1-like [Durio zibethinus] ref|XP_022742385.1| microfibrillar-associated protein 1-like [Durio zibethinus] Length = 433 Score = 82.8 bits (203), Expect(2) = 4e-21 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAGVS+ IA+RDKLRGKIGQTKVKRYWPGKAPEWA+DA Sbjct: 1 MSVTAGVSDTVIAIRDKLRGKIGQTKVKRYWPGKAPEWADDA 42 Score = 46.2 bits (108), Expect(2) = 4e-21 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEEN 90 AE + ++++EIR AHRRIRQAEIV+T EEEN Sbjct: 80 AESKIDNRDEIRAAHRRIRQAEIVSTEEEEN 110 >gb|PAN11213.1| hypothetical protein PAHAL_B03196 [Panicum hallii] Length = 428 Score = 84.3 bits (207), Expect(2) = 4e-21 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSV AGVS+AAIAVRDKLRGKIGQTKVKRYWPGKAPEWA+DA Sbjct: 1 MSVAAGVSDAAIAVRDKLRGKIGQTKVKRYWPGKAPEWADDA 42 Score = 44.7 bits (104), Expect(2) = 4e-21 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = -1 Query: 167 EDKEEIREAHRRIRQAEIVATIEEEN 90 E+KEE+R HRRIRQAEIV+T+EEEN Sbjct: 83 ENKEELRADHRRIRQAEIVSTVEEEN 108 >ref|XP_023766377.1| microfibrillar-associated protein 1-like [Lactuca sativa] ref|XP_023766378.1| microfibrillar-associated protein 1-like [Lactuca sativa] ref|XP_023766379.1| microfibrillar-associated protein 1-like [Lactuca sativa] ref|XP_023766380.1| microfibrillar-associated protein 1-like [Lactuca sativa] ref|XP_023766381.1| microfibrillar-associated protein 1-like [Lactuca sativa] gb|PLY83562.1| hypothetical protein LSAT_1X55421 [Lactuca sativa] Length = 432 Score = 81.6 bits (200), Expect(2) = 5e-21 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAED 236 MSVTAGVS+ IAVRDKLRGKIGQTKVKRYWPGKAPEWA+D Sbjct: 1 MSVTAGVSDTVIAVRDKLRGKIGQTKVKRYWPGKAPEWADD 41 Score = 47.0 bits (110), Expect(2) = 5e-21 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEE 93 AE RF++KEEIR HRRIRQAEI++T EEE Sbjct: 80 AENRFDNKEEIRADHRRIRQAEIISTEEEE 109 >ref|XP_019188672.1| PREDICTED: microfibrillar-associated protein 1-like [Ipomoea nil] ref|XP_019188680.1| PREDICTED: microfibrillar-associated protein 1-like [Ipomoea nil] ref|XP_019188689.1| PREDICTED: microfibrillar-associated protein 1-like [Ipomoea nil] ref|XP_019188698.1| PREDICTED: microfibrillar-associated protein 1-like [Ipomoea nil] Length = 430 Score = 80.1 bits (196), Expect(2) = 5e-21 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -2 Query: 358 MSVTAGVSEAAIAVRDKLRGKIGQTKVKRYWPGKAPEWAEDA 233 MSVTAGVS+ IAVR+KLRGKIGQTKVKRYWPGKAPEWA++A Sbjct: 1 MSVTAGVSDTVIAVREKLRGKIGQTKVKRYWPGKAPEWADEA 42 Score = 48.5 bits (114), Expect(2) = 5e-21 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 182 AEGRFEDKEEIREAHRRIRQAEIVATIEEEN 90 AE R +++EE+R HRRIRQAEIV+TIEEEN Sbjct: 80 AESRIDNREEVRADHRRIRQAEIVSTIEEEN 110