BLASTX nr result
ID: Ophiopogon23_contig00019996
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00019996 (340 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266850.1| WRKY transcription factor 22-like [Asparagus... 66 2e-10 >ref|XP_020266850.1| WRKY transcription factor 22-like [Asparagus officinalis] gb|ONK80301.1| uncharacterized protein A4U43_C01F16100 [Asparagus officinalis] Length = 285 Score = 66.2 bits (160), Expect = 2e-10 Identities = 36/47 (76%), Positives = 38/47 (80%) Frame = +3 Query: 147 NSKENDQLAPSPATSVSVDGDEEGELMVEDMEMIGEDELVFVGDALE 287 NSKE DQ PSPATS S++ DE GELMVEDMEMIGE ELVFVGD E Sbjct: 196 NSKEADQPPPSPATSPSMEEDE-GELMVEDMEMIGEHELVFVGDGSE 241