BLASTX nr result
ID: Ophiopogon23_contig00019923
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00019923 (494 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK81910.1| uncharacterized protein A4U43_C01F34180 [Asparagu... 60 1e-07 ref|XP_020267707.1| uncharacterized protein LOC109843154 [Aspara... 60 2e-07 >gb|ONK81910.1| uncharacterized protein A4U43_C01F34180 [Asparagus officinalis] Length = 219 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +1 Query: 1 GERLLRPSMVKVSAGPGPEKSIEDEIPPADDEFPSSGKEQ 120 GERLLRPSMVKVSAGPGP+KS ED IPPAD+ KE+ Sbjct: 166 GERLLRPSMVKVSAGPGPDKSDEDPIPPADEGISPVVKEE 205 >ref|XP_020267707.1| uncharacterized protein LOC109843154 [Asparagus officinalis] Length = 333 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +1 Query: 1 GERLLRPSMVKVSAGPGPEKSIEDEIPPADDEFPSSGKEQ 120 GERLLRPSMVKVSAGPGP+KS ED IPPAD+ KE+ Sbjct: 280 GERLLRPSMVKVSAGPGPDKSDEDPIPPADEGISPVVKEE 319