BLASTX nr result
ID: Ophiopogon23_contig00019732
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00019732 (636 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020260141.1| pentatricopeptide repeat-containing protein ... 86 8e-16 ref|XP_008381039.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-07 ref|XP_008810281.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-07 ref|XP_010918335.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 59 1e-06 ref|XP_009339758.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_022739507.1| pentatricopeptide repeat-containing protein ... 58 3e-06 ref|XP_011469345.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_011469344.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_004308566.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_007219485.2| pentatricopeptide repeat-containing protein ... 57 6e-06 ref|XP_021618834.1| pentatricopeptide repeat-containing protein ... 57 9e-06 ref|XP_021829728.1| pentatricopeptide repeat-containing protein ... 57 9e-06 ref|XP_008231855.1| PREDICTED: pentatricopeptide repeat-containi... 57 9e-06 >ref|XP_020260141.1| pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Asparagus officinalis] gb|ONK71060.1| uncharacterized protein A4U43_C04F4290 [Asparagus officinalis] Length = 599 Score = 85.9 bits (211), Expect = 8e-16 Identities = 41/68 (60%), Positives = 51/68 (75%) Frame = -2 Query: 629 SYSALIGALCRQGDVGRAYSLLVQMVQRGVVPDRFTWNCLLSSETFAVAIESWNRAMVDA 450 SY+ LI +LC+QGD GRAY+ LVQMV+RG+VPD FTW+C L +E F + +ES RAM DA Sbjct: 533 SYNPLICSLCKQGDEGRAYNFLVQMVERGIVPDSFTWSCFLVNERFEMKLESTTRAM-DA 591 Query: 449 LCNGCATD 426 LCN D Sbjct: 592 LCNNYTDD 599 >ref|XP_008381039.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Malus domestica] ref|XP_017189623.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Malus domestica] Length = 648 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -2 Query: 632 GSYSALIGALCRQGDVGRAYSLLVQMVQRGVVPDRFTWNCLL 507 GSY L+ LCR GD +A L++QMVQRG+VPD FTWN LL Sbjct: 579 GSYGPLVAVLCRMGDFQKALRLVLQMVQRGIVPDYFTWNSLL 620 >ref|XP_008810281.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Phoenix dactylifera] Length = 666 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/55 (50%), Positives = 40/55 (72%) Frame = -2 Query: 629 SYSALIGALCRQGDVGRAYSLLVQMVQRGVVPDRFTWNCLLSSETFAVAIESWNR 465 SYS+LI LC+QGD+ +A+ LVQMV+ V+PD+ TWN LL+SE + E+ N+ Sbjct: 601 SYSSLICGLCKQGDLDKAFGFLVQMVEADVIPDQDTWNSLLTSEQPWLKCENGNQ 655 >ref|XP_010918335.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Elaeis guineensis] Length = 631 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/65 (44%), Positives = 44/65 (67%) Frame = -2 Query: 635 AGSYSALIGALCRQGDVGRAYSLLVQMVQRGVVPDRFTWNCLLSSETFAVAIESWNRAMV 456 A SY +LI LC+QGD+ +A+ LVQMV+ ++PD+ TWN LL S+ + E+ N+ + Sbjct: 564 ADSYGSLICGLCKQGDLDKAFGFLVQMVEADLIPDQDTWNSLLMSKQPCLKCENGNQ-IN 622 Query: 455 DALCN 441 D LC+ Sbjct: 623 DVLCS 627 >ref|XP_009339758.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Pyrus x bretschneideri] ref|XP_009339759.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Pyrus x bretschneideri] Length = 648 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -2 Query: 632 GSYSALIGALCRQGDVGRAYSLLVQMVQRGVVPDRFTWNCLL 507 GSY L+ LCR GD +A L++QMV+RG+VPD FTWN LL Sbjct: 579 GSYGPLVAVLCRMGDFQKALRLVLQMVERGIVPDYFTWNSLL 620 >ref|XP_022739507.1| pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Durio zibethinus] Length = 638 Score = 58.2 bits (139), Expect = 3e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -2 Query: 632 GSYSALIGALCRQGDVGRAYSLLVQMVQRGVVPDRFTWNCLL 507 GSYS LI ALCR GD+ A LL+QM+Q+ ++PD FTWN +L Sbjct: 569 GSYSPLIEALCRMGDIQMAVMLLLQMLQKSIIPDDFTWNSIL 610 >ref|XP_011469345.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial isoform X3 [Fragaria vesca subsp. vesca] Length = 523 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = -2 Query: 629 SYSALIGALCRQGDVGRAYSLLVQMVQRGVVPDRFTWNCLL 507 SYS L+G LC++GD +A +LL QMV++G+ PD FTWN LL Sbjct: 455 SYSHLVGVLCQKGDFQKALTLLFQMVEKGITPDHFTWNSLL 495 >ref|XP_011469344.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] Length = 582 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = -2 Query: 629 SYSALIGALCRQGDVGRAYSLLVQMVQRGVVPDRFTWNCLL 507 SYS L+G LC++GD +A +LL QMV++G+ PD FTWN LL Sbjct: 514 SYSHLVGVLCQKGDFQKALTLLFQMVEKGITPDHFTWNSLL 554 >ref|XP_004308566.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial isoform X1 [Fragaria vesca subsp. vesca] Length = 612 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = -2 Query: 629 SYSALIGALCRQGDVGRAYSLLVQMVQRGVVPDRFTWNCLL 507 SYS L+G LC++GD +A +LL QMV++G+ PD FTWN LL Sbjct: 544 SYSHLVGVLCQKGDFQKALTLLFQMVEKGITPDHFTWNSLL 584 >ref|XP_007219485.2| pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Prunus persica] ref|XP_020411999.1| pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Prunus persica] ref|XP_020412000.1| pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Prunus persica] gb|ONI21445.1| hypothetical protein PRUPE_2G066000 [Prunus persica] Length = 645 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -2 Query: 635 AGSYSALIGALCRQGDVGRAYSLLVQMVQRGVVPDRFTWNCLL 507 A SYS L+ ALC GD +A L++QMV++GV+PD FTWN LL Sbjct: 575 ARSYSPLVAALCHMGDFQKALRLVLQMVEKGVIPDYFTWNSLL 617 >ref|XP_021618834.1| pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Manihot esculenta] gb|OAY61004.1| hypothetical protein MANES_01G156100 [Manihot esculenta] Length = 631 Score = 56.6 bits (135), Expect = 9e-06 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = -2 Query: 632 GSYSALIGALCRQGDVGRAYSLLVQMVQRGVVPDRFTWN-CLLSSETFAVAIESWN 468 GSY LI ALCR+G +A++L +QMV++G PD TWN LL ++ +E+WN Sbjct: 562 GSYGPLIDALCRKGSFQKAFNLFLQMVEKGATPDYLTWNSLLLCLSQQSIWLENWN 617 >ref|XP_021829728.1| pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Prunus avium] ref|XP_021829729.1| pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Prunus avium] ref|XP_021829730.1| pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Prunus avium] Length = 634 Score = 56.6 bits (135), Expect = 9e-06 Identities = 24/43 (55%), Positives = 32/43 (74%) Frame = -2 Query: 635 AGSYSALIGALCRQGDVGRAYSLLVQMVQRGVVPDRFTWNCLL 507 A SYS L+ ALC GD +A L++QMV++G++PD FTWN LL Sbjct: 564 ARSYSPLVAALCHMGDFQKALRLVLQMVEKGIIPDYFTWNSLL 606 >ref|XP_008231855.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial [Prunus mume] Length = 634 Score = 56.6 bits (135), Expect = 9e-06 Identities = 24/43 (55%), Positives = 32/43 (74%) Frame = -2 Query: 635 AGSYSALIGALCRQGDVGRAYSLLVQMVQRGVVPDRFTWNCLL 507 A SYS L+ ALC GD +A L++QMV++G++PD FTWN LL Sbjct: 564 ARSYSPLVAALCHMGDFQKALRLVLQMVEKGIIPDYFTWNSLL 606