BLASTX nr result
ID: Ophiopogon23_contig00019549
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00019549 (562 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245468.1| type I inositol polyphosphate 5-phosphatase ... 65 9e-09 >ref|XP_020245468.1| type I inositol polyphosphate 5-phosphatase 12-like [Asparagus officinalis] Length = 984 Score = 64.7 bits (156), Expect = 9e-09 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -2 Query: 561 EAILTVNITGNWSTQKKCQRIRIRQCNSAKMSCKESNSALTRNQSK 424 EAILTVNITG+W T KKC +IR+ Q +++K C ESN LTRNQSK Sbjct: 937 EAILTVNITGSWCTGKKCHQIRVLQSSTSKNPCTESNRTLTRNQSK 982