BLASTX nr result
ID: Ophiopogon23_contig00018483
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00018483 (382 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020249204.1| single-stranded DNA-bindig protein WHY2, mit... 88 4e-18 gb|ONK56487.1| uncharacterized protein A4U43_C10F9260 [Asparagus... 88 5e-18 gb|OVA05795.1| Plant transcription factor [Macleaya cordata] 69 3e-11 ref|XP_008803798.1| PREDICTED: single-stranded DNA-bindig protei... 68 5e-11 ref|XP_010912668.1| PREDICTED: single-stranded DNA-bindig protei... 65 3e-10 ref|XP_010927809.1| PREDICTED: single-stranded DNA-bindig protei... 65 3e-10 ref|XP_020107565.1| single-stranded DNA-bindig protein WHY2, mit... 64 1e-09 gb|PIA47076.1| hypothetical protein AQUCO_01400047v1 [Aquilegia ... 63 3e-09 ref|XP_008795280.1| PREDICTED: single-stranded DNA-bindig protei... 63 3e-09 ref|XP_008795279.1| PREDICTED: single-stranded DNA-bindig protei... 63 3e-09 ref|XP_017699270.1| PREDICTED: single-stranded DNA-bindig protei... 63 4e-09 ref|XP_017699269.1| PREDICTED: single-stranded DNA-bindig protei... 63 4e-09 gb|AIA25913.1| plant transcriptional regulator PBF-2, partial [F... 57 6e-08 ref|XP_020589124.1| single-stranded DNA-binding protein WHY2, mi... 58 2e-07 ref|XP_020589123.1| single-stranded DNA-binding protein WHY2, mi... 58 2e-07 ref|XP_020589120.1| single-stranded DNA-binding protein WHY2, mi... 58 2e-07 ref|XP_006646903.1| PREDICTED: single-stranded DNA-binding prote... 57 3e-07 gb|OEL22532.1| Single-stranded DNA-bindig protein WHY2, mitochon... 57 4e-07 ref|XP_003574931.1| PREDICTED: single-stranded DNA-binding prote... 57 4e-07 ref|XP_017249282.1| PREDICTED: single-stranded DNA-bindig protei... 57 4e-07 >ref|XP_020249204.1| single-stranded DNA-bindig protein WHY2, mitochondrial-like [Asparagus officinalis] Length = 327 Score = 87.8 bits (216), Expect = 4e-18 Identities = 41/53 (77%), Positives = 45/53 (84%), Gaps = 2/53 (3%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQL--SGAPGQMKEPEMRLSPDFEWGR 230 KAEFAVMRTAFGFALPHIMGWDR+VTPQ + Q+KEP MRL+PDFEWGR Sbjct: 275 KAEFAVMRTAFGFALPHIMGWDRVVTPQFVNTSNSAQLKEPTMRLTPDFEWGR 327 >gb|ONK56487.1| uncharacterized protein A4U43_C10F9260 [Asparagus officinalis] Length = 345 Score = 87.8 bits (216), Expect = 5e-18 Identities = 41/53 (77%), Positives = 45/53 (84%), Gaps = 2/53 (3%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQL--SGAPGQMKEPEMRLSPDFEWGR 230 KAEFAVMRTAFGFALPHIMGWDR+VTPQ + Q+KEP MRL+PDFEWGR Sbjct: 293 KAEFAVMRTAFGFALPHIMGWDRVVTPQFVNTSNSAQLKEPTMRLTPDFEWGR 345 >gb|OVA05795.1| Plant transcription factor [Macleaya cordata] Length = 261 Score = 68.6 bits (166), Expect = 3e-11 Identities = 32/51 (62%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQL--SGAPGQMKEPEMRLSPDFEW 236 KAEFAVMRT+F F LPHIMGWDRL Q+ S + M++PEM+L+PD EW Sbjct: 191 KAEFAVMRTSFSFILPHIMGWDRLFNHQVPASTSVSPMRQPEMQLNPDLEW 241 >ref|XP_008803798.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial-like isoform X2 [Phoenix dactylifera] Length = 241 Score = 67.8 bits (164), Expect = 5e-11 Identities = 32/52 (61%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLSGAPGQM-KEPEMRLSPDFEWGR 230 KAEFAV+R AF F LP+IMGWD++V PQL G+ K+ EMR PDFEW R Sbjct: 190 KAEFAVVRAAFSFILPYIMGWDQVVKPQLESVEGERPKQREMRPDPDFEWER 241 >ref|XP_010912668.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial [Elaeis guineensis] Length = 238 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/53 (56%), Positives = 37/53 (69%), Gaps = 2/53 (3%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLSGAPGQ--MKEPEMRLSPDFEWGR 230 KAEFAVMRTA +ALPHIMGWD+++ PQL P + ++ PDFEWGR Sbjct: 186 KAEFAVMRTALSYALPHIMGWDQVIRPQLPNIPRSTPKHQSDVLPDPDFEWGR 238 >ref|XP_010927809.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial [Elaeis guineensis] Length = 241 Score = 65.5 bits (158), Expect = 3e-10 Identities = 32/53 (60%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLS--GAPGQMKEPEMRLSPDFEWGR 230 KAEFAVMR AF F LP+IMGWD+++ P+L G M+ EMR PDFEWGR Sbjct: 190 KAEFAVMRAAFSFVLPYIMGWDQVIKPKLESIGVERPMQR-EMRADPDFEWGR 241 >ref|XP_020107565.1| single-stranded DNA-bindig protein WHY2, mitochondrial isoform X1 [Ananas comosus] gb|OAY71645.1| Single-stranded DNA-bindig protein WHY2, mitochondrial [Ananas comosus] Length = 236 Score = 63.9 bits (154), Expect = 1e-09 Identities = 28/53 (52%), Positives = 37/53 (69%), Gaps = 2/53 (3%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLSGAPGQ--MKEPEMRLSPDFEWGR 230 +AEF VMRTAF + LPH+MGWD+ V P+ + P ++ E R +PDFEWGR Sbjct: 184 RAEFTVMRTAFSYVLPHLMGWDQAVRPRQANTPASPLKQQVEERPNPDFEWGR 236 >gb|PIA47076.1| hypothetical protein AQUCO_01400047v1 [Aquilegia coerulea] Length = 226 Score = 62.8 bits (151), Expect = 3e-09 Identities = 31/53 (58%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLSGAPGQ--MKEPEMRLSPDFEWGR 230 KAE+ VMRTAF F LPHIMGW++ +T Q+S + Q M++ EMRLSP EW R Sbjct: 175 KAEYTVMRTAFSFILPHIMGWNQ-ITQQVSASSDQNPMRQQEMRLSPALEWNR 226 >ref|XP_008795280.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X4 [Phoenix dactylifera] Length = 242 Score = 62.8 bits (151), Expect = 3e-09 Identities = 29/53 (54%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLSGAPGQ--MKEPEMRLSPDFEWGR 230 KAEFAVMRTA + LPHIMGWD+++ P+L P + E+ PDFEWGR Sbjct: 190 KAEFAVMRTALSYVLPHIMGWDQVIGPRLPNIPQNTPRQRREVLPDPDFEWGR 242 >ref|XP_008795279.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X3 [Phoenix dactylifera] Length = 243 Score = 62.8 bits (151), Expect = 3e-09 Identities = 29/53 (54%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLSGAPGQ--MKEPEMRLSPDFEWGR 230 KAEFAVMRTA + LPHIMGWD+++ P+L P + E+ PDFEWGR Sbjct: 191 KAEFAVMRTALSYVLPHIMGWDQVIGPRLPNIPQNTPRQRREVLPDPDFEWGR 243 >ref|XP_017699270.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2 [Phoenix dactylifera] Length = 247 Score = 62.8 bits (151), Expect = 4e-09 Identities = 29/53 (54%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLSGAPGQ--MKEPEMRLSPDFEWGR 230 KAEFAVMRTA + LPHIMGWD+++ P+L P + E+ PDFEWGR Sbjct: 195 KAEFAVMRTALSYVLPHIMGWDQVIGPRLPNIPQNTPRQRREVLPDPDFEWGR 247 >ref|XP_017699269.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X1 [Phoenix dactylifera] Length = 248 Score = 62.8 bits (151), Expect = 4e-09 Identities = 29/53 (54%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLSGAPGQ--MKEPEMRLSPDFEWGR 230 KAEFAVMRTA + LPHIMGWD+++ P+L P + E+ PDFEWGR Sbjct: 196 KAEFAVMRTALSYVLPHIMGWDQVIGPRLPNIPQNTPRQRREVLPDPDFEWGR 248 >gb|AIA25913.1| plant transcriptional regulator PBF-2, partial [Fargesia nitida] Length = 93 Score = 56.6 bits (135), Expect = 6e-08 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLSGAPGQMKEPEMRLSPDFEWGR 230 KAEFAVMRTA FALPHIMGWD+++T K R PD EW R Sbjct: 43 KAEFAVMRTALSFALPHIMGWDQVLTNHHPSPSSASKPRVERPHPDSEWER 93 >ref|XP_020589124.1| single-stranded DNA-binding protein WHY2, mitochondrial isoform X3 [Phalaenopsis equestris] Length = 234 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/52 (51%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLSGAP-GQMKEPEMRLSPDFEWGR 230 KAEF VMRTA GF LP IMGWDR++ P + A G ++ +++ PD EW R Sbjct: 183 KAEFCVMRTACGFVLPLIMGWDRVIGPHVDRADHGSSEQSVVKMDPDLEWER 234 >ref|XP_020589123.1| single-stranded DNA-binding protein WHY2, mitochondrial isoform X2 [Phalaenopsis equestris] Length = 271 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/52 (51%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLSGAP-GQMKEPEMRLSPDFEWGR 230 KAEF VMRTA GF LP IMGWDR++ P + A G ++ +++ PD EW R Sbjct: 220 KAEFCVMRTACGFVLPLIMGWDRVIGPHVDRADHGSSEQSVVKMDPDLEWER 271 >ref|XP_020589120.1| single-stranded DNA-binding protein WHY2, mitochondrial isoform X1 [Phalaenopsis equestris] ref|XP_020589122.1| single-stranded DNA-binding protein WHY2, mitochondrial isoform X1 [Phalaenopsis equestris] Length = 279 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/52 (51%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLSGAP-GQMKEPEMRLSPDFEWGR 230 KAEF VMRTA GF LP IMGWDR++ P + A G ++ +++ PD EW R Sbjct: 228 KAEFCVMRTACGFVLPLIMGWDRVIGPHVDRADHGSSEQSVVKMDPDLEWER 279 >ref|XP_006646903.1| PREDICTED: single-stranded DNA-binding protein WHY2, mitochondrial [Oryza brachyantha] Length = 230 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/51 (52%), Positives = 31/51 (60%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLSGAPGQMKEPEMRLSPDFEWGR 230 KAEFAVMRT FALPHI+GWD+++T P K R PD EW R Sbjct: 180 KAEFAVMRTTLSFALPHILGWDQVLTNHHPSPPAASKPRAERPHPDSEWER 230 >gb|OEL22532.1| Single-stranded DNA-bindig protein WHY2, mitochondrial [Dichanthelium oligosanthes] Length = 198 Score = 56.6 bits (135), Expect = 4e-07 Identities = 29/51 (56%), Positives = 32/51 (62%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVTPQLSGAPGQMKEPEMRLSPDFEWGR 230 KAEFAVMRTA FALPHIMGWD+++T P K R PD EW R Sbjct: 149 KAEFAVMRTALSFALPHIMGWDQVLTHH-PAPPASSKPRVERPHPDSEWER 198 >ref|XP_003574931.1| PREDICTED: single-stranded DNA-binding protein WHY2, mitochondrial [Brachypodium distachyon] gb|KQJ93415.1| hypothetical protein BRADI_3g04450v3 [Brachypodium distachyon] Length = 231 Score = 57.0 bits (136), Expect = 4e-07 Identities = 31/53 (58%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVT--PQLSGAPGQMKEPEMRLSPDFEWGR 230 KAEFAVMRTA +ALPHIMGWD+ +T PQ AP E R PD EW R Sbjct: 180 KAEFAVMRTALSYALPHIMGWDQALTSHPQSPTAPASKPRVE-RPHPDSEWER 231 >ref|XP_017249282.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial-like isoform X2 [Daucus carota subsp. sativus] Length = 232 Score = 57.0 bits (136), Expect = 4e-07 Identities = 30/52 (57%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = -1 Query: 382 KAEFAVMRTAFGFALPHIMGWDRLVT-PQLSGAPGQMKEPEMRLSPDFEWGR 230 KAEFAVMRTAF FALPHIMGWDR + P S A M +P ++ + EW R Sbjct: 184 KAEFAVMRTAFSFALPHIMGWDRYINQPPKSIANAPMVDPRVK---NLEWDR 232