BLASTX nr result
ID: Ophiopogon23_contig00018286
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00018286 (523 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OXU27658.1| hypothetical protein TSAR_014528 [Trichomalopsis ... 71 6e-12 ref|XP_001607205.1| PREDICTED: cell wall protein DAN4 [Nasonia v... 71 7e-12 ref|XP_014224618.1| integumentary mucin C.1-like [Trichogramma p... 66 2e-10 ref|XP_011494452.1| PREDICTED: integumentary mucin C.1-like [Cer... 65 1e-09 ref|XP_014206908.1| integumentary mucin C.1 [Copidosoma floridan... 63 3e-09 ref|XP_017880519.1| PREDICTED: integumentary mucin C.1-like [Cer... 62 1e-08 ref|XP_003706323.1| PREDICTED: sialomucin core protein 24-like [... 62 2e-08 ref|XP_015429459.1| PREDICTED: cell wall integrity and stress re... 60 5e-08 ref|XP_018320919.1| PREDICTED: threonine-rich protein isoform X3... 59 1e-07 ref|XP_018320918.1| PREDICTED: sialomucin core protein 24 isofor... 59 1e-07 ref|XP_015514781.1| PREDICTED: integumentary mucin A.1-like [Neo... 59 1e-07 ref|XP_012217317.1| PREDICTED: cell wall protein DAN4-like [Line... 59 2e-07 ref|XP_018320916.1| PREDICTED: sialomucin core protein 24 isofor... 59 2e-07 ref|XP_011256084.1| PREDICTED: integumentary mucin C.1 [Camponot... 58 3e-07 ref|XP_011333314.1| PREDICTED: integumentary mucin C.1 [Ooceraea... 58 5e-07 ref|XP_014489514.1| PREDICTED: cell wall protein DAN4-like [Dino... 57 6e-07 ref|XP_015922515.1| sialomucin core protein 24 [Parasteatoda tep... 57 6e-07 gb|KOX69788.1| hypothetical protein WN51_05074 [Melipona quadrif... 58 6e-07 ref|XP_016908353.1| PREDICTED: sialomucin core protein 24-like [... 57 7e-07 ref|XP_006559151.1| PREDICTED: sialomucin core protein 24 [Apis ... 57 7e-07 >gb|OXU27658.1| hypothetical protein TSAR_014528 [Trichomalopsis sarcophagae] Length = 192 Score = 70.9 bits (172), Expect = 6e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 210 GRHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 GRHFDGLSF+GGIILTT ++ L V S+KFYKIKTERSYRTL Sbjct: 152 GRHFDGLSFLGGIILTTCLVGLSVGSYKFYKIKTERSYRTL 192 >ref|XP_001607205.1| PREDICTED: cell wall protein DAN4 [Nasonia vitripennis] Length = 199 Score = 70.9 bits (172), Expect = 7e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 210 GRHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 GRHFDGLSF+GGIILTT ++ L V S+KFYKIKTERSYRTL Sbjct: 159 GRHFDGLSFLGGIILTTCLVGLSVGSYKFYKIKTERSYRTL 199 >ref|XP_014224618.1| integumentary mucin C.1-like [Trichogramma pretiosum] Length = 170 Score = 66.2 bits (160), Expect = 2e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -2 Query: 210 GRHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 GR FDGLSFMGGIILT ++ L V +KFYKIKTERSYRTL Sbjct: 130 GRQFDGLSFMGGIILTACIVGLSVGGYKFYKIKTERSYRTL 170 >ref|XP_011494452.1| PREDICTED: integumentary mucin C.1-like [Ceratosolen solmsi marchali] Length = 187 Score = 64.7 bits (156), Expect = 1e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -2 Query: 210 GRHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 GRHFDG+SFMGGIILT ++ LGV +KFYKIK E+SY TL Sbjct: 147 GRHFDGISFMGGIILTACIVGLGVGFYKFYKIKNEQSYHTL 187 >ref|XP_014206908.1| integumentary mucin C.1 [Copidosoma floridanum] ref|XP_014206916.1| integumentary mucin C.1 [Copidosoma floridanum] ref|XP_014206923.1| integumentary mucin C.1 [Copidosoma floridanum] Length = 163 Score = 63.2 bits (152), Expect = 3e-09 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -2 Query: 216 KPGRHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 K G FDGLSFM GII+TT V+ LG + KFYKIKT+RSYRTL Sbjct: 121 KGGHSFDGLSFMAGIIMTTCVVGLGAGAIKFYKIKTDRSYRTL 163 >ref|XP_017880519.1| PREDICTED: integumentary mucin C.1-like [Ceratina calcarata] Length = 210 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 207 RHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 RHFDGLSFMGGIIL T ++A+GV S+KFY+ ER+YRTL Sbjct: 171 RHFDGLSFMGGIILATCLMAIGVLSWKFYRTFNERNYRTL 210 >ref|XP_003706323.1| PREDICTED: sialomucin core protein 24-like [Megachile rotundata] Length = 233 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 207 RHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 RHFDGLSF+GGIIL T ++A+GV S+KFYK +ER YRTL Sbjct: 194 RHFDGLSFLGGIILATSLMAIGVLSWKFYKTFSERDYRTL 233 >ref|XP_015429459.1| PREDICTED: cell wall integrity and stress response component 4-like [Dufourea novaeangliae] Length = 203 Score = 60.5 bits (145), Expect = 5e-08 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -2 Query: 210 GRHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 GRHFDGLSF+GGIILT ++A+GV S+KF++ +E +YRTL Sbjct: 163 GRHFDGLSFLGGIILTVCLMAIGVISWKFFRTMSEGNYRTL 203 >ref|XP_018320919.1| PREDICTED: threonine-rich protein isoform X3 [Agrilus planipennis] Length = 160 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -2 Query: 210 GRHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 GRHFDG SF+GGI+L + ++A+G +FKFYK +TER+Y TL Sbjct: 120 GRHFDGPSFIGGIVLASGLMAIGFVAFKFYKARTERNYHTL 160 >ref|XP_018320918.1| PREDICTED: sialomucin core protein 24 isoform X2 [Agrilus planipennis] Length = 171 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -2 Query: 210 GRHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 GRHFDG SF+GGI+L + ++A+G +FKFYK +TER+Y TL Sbjct: 131 GRHFDGPSFIGGIVLASGLMAIGFVAFKFYKARTERNYHTL 171 >ref|XP_015514781.1| PREDICTED: integumentary mucin A.1-like [Neodiprion lecontei] Length = 175 Score = 58.9 bits (141), Expect = 1e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -2 Query: 207 RHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 RHFDGLSFMGGIILT ++A+G +KFYK +TER+Y TL Sbjct: 136 RHFDGLSFMGGIILTGGLVAIGFILWKFYKARTERNYHTL 175 >ref|XP_012217317.1| PREDICTED: cell wall protein DAN4-like [Linepithema humile] Length = 196 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -2 Query: 207 RHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 RHFDGLSF GGIILTT ++A+ VFS+KFY+ E +YRTL Sbjct: 157 RHFDGLSFFGGIILTTCLMAIAVFSWKFYRQCNEGNYRTL 196 >ref|XP_018320916.1| PREDICTED: sialomucin core protein 24 isoform X1 [Agrilus planipennis] ref|XP_018320917.1| PREDICTED: sialomucin core protein 24 isoform X1 [Agrilus planipennis] Length = 203 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -2 Query: 210 GRHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 GRHFDG SF+GGI+L + ++A+G +FKFYK +TER+Y TL Sbjct: 163 GRHFDGPSFIGGIVLASGLMAIGFVAFKFYKARTERNYHTL 203 >ref|XP_011256084.1| PREDICTED: integumentary mucin C.1 [Camponotus floridanus] gb|EFN68381.1| hypothetical protein EAG_10354 [Camponotus floridanus] Length = 184 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -2 Query: 207 RHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 RHFDGLSF GGIIL T ++A+ FS+KFY+ ER+YRTL Sbjct: 145 RHFDGLSFFGGIILATCLMAIATFSWKFYRQCNERNYRTL 184 >ref|XP_011333314.1| PREDICTED: integumentary mucin C.1 [Ooceraea biroi] Length = 205 Score = 57.8 bits (138), Expect = 5e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -2 Query: 207 RHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 RHFDGLSF GGIIL T ++A+ FS+KFY+ ER+YRTL Sbjct: 166 RHFDGLSFFGGIILATCLMAVAAFSWKFYRQCNERNYRTL 205 >ref|XP_014489514.1| PREDICTED: cell wall protein DAN4-like [Dinoponera quadriceps] Length = 184 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -2 Query: 207 RHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 RHFDGLSF GGIIL T ++A+ VF++KFYK +E +YRTL Sbjct: 145 RHFDGLSFFGGIILATCLMAISVFAWKFYKQCSEGNYRTL 184 >ref|XP_015922515.1| sialomucin core protein 24 [Parasteatoda tepidariorum] Length = 163 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -2 Query: 213 PGRHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 PGRHFD SF+GGI+L +LA+ SFKFYK +TER+Y TL Sbjct: 122 PGRHFDAPSFIGGIVLALGLLAIIYISFKFYKARTERNYHTL 163 >gb|KOX69788.1| hypothetical protein WN51_05074 [Melipona quadrifasciata] Length = 211 Score = 57.8 bits (138), Expect = 6e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -2 Query: 207 RHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 RHFDGLSF+GGIIL T ++A+GV S+K YK E++YRTL Sbjct: 172 RHFDGLSFLGGIILATCLMAIGVLSWKSYKTFNEQNYRTL 211 >ref|XP_016908353.1| PREDICTED: sialomucin core protein 24-like [Apis cerana] gb|PBC29068.1| Sialomucin core protein [Apis cerana cerana] Length = 197 Score = 57.4 bits (137), Expect = 7e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -2 Query: 207 RHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 RHFDGLSF+GGIIL T ++A+G S+KFY+ E++YRTL Sbjct: 158 RHFDGLSFLGGIILATGLMAIGALSWKFYRTLNEQNYRTL 197 >ref|XP_006559151.1| PREDICTED: sialomucin core protein 24 [Apis mellifera] Length = 197 Score = 57.4 bits (137), Expect = 7e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -2 Query: 207 RHFDGLSFMGGIILTTLVLALGVFSFKFYKIKTERSYRTL 88 RHFDGLSF+GGIIL T ++A+G S+KFY+ E++YRTL Sbjct: 158 RHFDGLSFLGGIILATGLMAIGALSWKFYRTLNEQNYRTL 197