BLASTX nr result
ID: Ophiopogon23_contig00018255
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00018255 (418 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021981739.1| UDP-N-acetylglucosamine transferase subunit ... 62 4e-09 ref|XP_021981737.1| UDP-N-acetylglucosamine transferase subunit ... 62 5e-09 gb|KVI06869.1| Oligosaccharide biosynthesis protein Alg14-like p... 63 9e-09 gb|KZV55332.1| hypothetical protein F511_44162 [Dorcoceras hygro... 59 6e-08 gb|KZV16338.1| hypothetical protein F511_36876 [Dorcoceras hygro... 59 6e-08 ref|XP_014617792.1| PREDICTED: UDP-N-acetylglucosamine transfera... 58 1e-07 ref|XP_020244435.1| UDP-N-acetylglucosamine transferase subunit ... 59 1e-07 gb|KZV32249.1| hypothetical protein F511_29428 [Dorcoceras hygro... 59 1e-07 ref|XP_016735832.1| PREDICTED: UDP-N-acetylglucosamine transfera... 58 1e-07 ref|XP_006587597.2| PREDICTED: UDP-N-acetylglucosamine transfera... 58 1e-07 ref|XP_019436823.1| PREDICTED: UDP-N-acetylglucosamine transfera... 59 2e-07 ref|XP_019436820.1| PREDICTED: UDP-N-acetylglucosamine transfera... 59 2e-07 ref|XP_020989315.1| UDP-N-acetylglucosamine transferase subunit ... 57 2e-07 ref|XP_012484801.1| PREDICTED: UDP-N-acetylglucosamine transfera... 58 2e-07 ref|XP_021994512.1| UDP-N-acetylglucosamine transferase subunit ... 58 3e-07 ref|XP_015946604.2| UDP-N-acetylglucosamine transferase subunit ... 57 3e-07 ref|XP_023760150.1| UDP-N-acetylglucosamine transferase subunit ... 58 3e-07 ref|XP_018819663.1| PREDICTED: UDP-N-acetylglucosamine transfera... 58 3e-07 gb|KHN38941.1| UDP-N-acetylglucosamine transferase subunit ALG14... 58 3e-07 ref|XP_017612090.1| PREDICTED: UDP-N-acetylglucosamine transfera... 58 3e-07 >ref|XP_021981739.1| UDP-N-acetylglucosamine transferase subunit ALG14-like isoform X3 [Helianthus annuus] Length = 203 Score = 62.4 bits (150), Expect = 4e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ+FVQWP LQKQY R HYVGRLM Sbjct: 172 LLYKLRMADQLFVQWPSLQKQYPRAHYVGRLM 203 >ref|XP_021981737.1| UDP-N-acetylglucosamine transferase subunit ALG14-like isoform X1 [Helianthus annuus] gb|OTG14368.1| hypothetical protein HannXRQ_Chr09g0248611 [Helianthus annuus] Length = 223 Score = 62.4 bits (150), Expect = 5e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ+FVQWP LQKQY R HYVGRLM Sbjct: 192 LLYKLRMADQLFVQWPSLQKQYPRAHYVGRLM 223 >gb|KVI06869.1| Oligosaccharide biosynthesis protein Alg14-like protein [Cynara cardunculus var. scolymus] Length = 334 Score = 62.8 bits (151), Expect = 9e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ+FVQWP+LQKQY R HYVGRLM Sbjct: 303 LLYKLRMADQLFVQWPQLQKQYPRAHYVGRLM 334 >gb|KZV55332.1| hypothetical protein F511_44162 [Dorcoceras hygrometricum] Length = 178 Score = 58.9 bits (141), Expect = 6e-08 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ+FVQWP+L+KQY R++YVGRLM Sbjct: 147 LLYKLRMADQLFVQWPQLKKQYPRSNYVGRLM 178 >gb|KZV16338.1| hypothetical protein F511_36876 [Dorcoceras hygrometricum] Length = 178 Score = 58.9 bits (141), Expect = 6e-08 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ+FVQWP+L+KQY R++YVGRLM Sbjct: 147 LLYKLRMADQLFVQWPQLKKQYPRSNYVGRLM 178 >ref|XP_014617792.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14 homolog isoform X2 [Glycine max] Length = 154 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ+FVQWP+LQ+QY R YVGRLM Sbjct: 123 LLYKLRMADQLFVQWPQLQRQYPRATYVGRLM 154 >ref|XP_020244435.1| UDP-N-acetylglucosamine transferase subunit ALG14 homolog [Asparagus officinalis] Length = 228 Score = 58.9 bits (141), Expect = 1e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKL LAD+IFVQWPKLQK+Y RT YVGRLM Sbjct: 197 LLYKLHLADRIFVQWPKLQKEYPRTIYVGRLM 228 >gb|KZV32249.1| hypothetical protein F511_29428 [Dorcoceras hygrometricum] Length = 240 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ+FVQWP+L+KQY R++YVGRLM Sbjct: 209 LLYKLRMADQLFVQWPQLKKQYPRSNYVGRLM 240 >ref|XP_016735832.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14-like [Gossypium hirsutum] Length = 167 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ FVQWP+LQ+QY R HYVG LM Sbjct: 136 LLYKLRIADQFFVQWPQLQRQYPRAHYVGCLM 167 >ref|XP_006587597.2| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14 homolog isoform X1 [Glycine max] Length = 168 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ+FVQWP+LQ+QY R YVGRLM Sbjct: 137 LLYKLRMADQLFVQWPQLQRQYPRATYVGRLM 168 >ref|XP_019436823.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14 homolog isoform X2 [Lupinus angustifolius] ref|XP_019436826.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14 homolog isoform X2 [Lupinus angustifolius] gb|OIW15683.1| hypothetical protein TanjilG_09621 [Lupinus angustifolius] gb|OIW15685.1| hypothetical protein TanjilG_09623 [Lupinus angustifolius] Length = 234 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ+FVQWPKLQ+QY R YVGRLM Sbjct: 203 LLYKLRMADQLFVQWPKLQQQYPRAIYVGRLM 234 >ref|XP_019436820.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14-like isoform X1 [Lupinus angustifolius] ref|XP_019436821.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14-like isoform X1 [Lupinus angustifolius] ref|XP_019436822.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14-like isoform X1 [Lupinus angustifolius] ref|XP_019436824.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14-like isoform X1 [Lupinus angustifolius] ref|XP_019436825.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14-like isoform X1 [Lupinus angustifolius] Length = 238 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ+FVQWPKLQ+QY R YVGRLM Sbjct: 207 LLYKLRMADQLFVQWPKLQQQYPRAIYVGRLM 238 >ref|XP_020989315.1| UDP-N-acetylglucosamine transferase subunit ALG14 homolog isoform X2 [Arachis duranensis] Length = 171 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ+FVQWP+LQ+QY R YVGRLM Sbjct: 140 LLYKLRIADQLFVQWPRLQQQYPRAIYVGRLM 171 >ref|XP_012484801.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14-like [Gossypium raimondii] ref|XP_012484802.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14-like [Gossypium raimondii] ref|XP_012484803.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14-like [Gossypium raimondii] gb|KJB34974.1| hypothetical protein B456_006G093500 [Gossypium raimondii] Length = 234 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ FVQWP+LQ++Y RTHYVG LM Sbjct: 203 LLYKLRIADQFFVQWPQLQRKYPRTHYVGCLM 234 >ref|XP_021994512.1| UDP-N-acetylglucosamine transferase subunit ALG14 homolog isoform X1 [Helianthus annuus] gb|OTG09041.1| putative UDP-N-acetylglucosamine transferase subunit [Helianthus annuus] Length = 217 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKL +ADQ+FVQWP+LQKQY R YVGRLM Sbjct: 186 LLYKLHMADQLFVQWPQLQKQYPRARYVGRLM 217 >ref|XP_015946604.2| UDP-N-acetylglucosamine transferase subunit ALG14 homolog isoform X1 [Arachis duranensis] Length = 191 Score = 57.4 bits (137), Expect = 3e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ+FVQWP+LQ+QY R YVGRLM Sbjct: 160 LLYKLRIADQLFVQWPRLQQQYPRAIYVGRLM 191 >ref|XP_023760150.1| UDP-N-acetylglucosamine transferase subunit ALG14 homolog [Lactuca sativa] ref|XP_023760204.1| UDP-N-acetylglucosamine transferase subunit ALG14 homolog [Lactuca sativa] ref|XP_023760251.1| UDP-N-acetylglucosamine transferase subunit ALG14 homolog [Lactuca sativa] Length = 219 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKL +ADQ+FVQWP+LQKQY R YVGRLM Sbjct: 188 LLYKLHMADQLFVQWPQLQKQYPRARYVGRLM 219 >ref|XP_018819663.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14 [Juglans regia] ref|XP_018819664.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14 [Juglans regia] Length = 225 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ FVQWP+LQ+QY R HYVG LM Sbjct: 194 LLYKLRIADQFFVQWPQLQRQYPRAHYVGCLM 225 >gb|KHN38941.1| UDP-N-acetylglucosamine transferase subunit ALG14 like [Glycine soja] Length = 233 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ+FVQWP+LQ+QY R YVGRLM Sbjct: 202 LLYKLRMADQLFVQWPQLQRQYPRATYVGRLM 233 >ref|XP_017612090.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14-like [Gossypium arboreum] ref|XP_017612091.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14-like [Gossypium arboreum] ref|XP_017612092.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14-like [Gossypium arboreum] Length = 234 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 LLYKLRLADQIFVQWPKLQKQYSRTHYVGRLM 96 LLYKLR+ADQ FVQWP+LQ+QY R HYVG LM Sbjct: 203 LLYKLRIADQFFVQWPQLQRQYPRAHYVGCLM 234