BLASTX nr result
ID: Ophiopogon23_contig00018204
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00018204 (381 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019701891.1| PREDICTED: PHD finger protein EHD3-like isof... 58 4e-07 ref|XP_019701890.1| PREDICTED: PHD finger protein EHD3-like isof... 58 4e-07 ref|XP_019701888.1| PREDICTED: PHD finger protein EHD3-like isof... 58 4e-07 ref|XP_010905320.1| PREDICTED: PHD finger protein EHD3-like isof... 58 4e-07 ref|XP_010905319.1| PREDICTED: PHD finger protein EHD3-like isof... 58 4e-07 ref|XP_008783327.1| PREDICTED: uncharacterized protein LOC103702... 57 6e-07 ref|XP_010911156.1| PREDICTED: PHD finger protein EHD3-like [Ela... 57 6e-07 ref|XP_008783326.1| PREDICTED: uncharacterized protein LOC103702... 57 6e-07 ref|XP_008783325.1| PREDICTED: uncharacterized protein LOC103702... 57 6e-07 ref|XP_017701103.1| PREDICTED: uncharacterized protein LOC103718... 56 2e-06 ref|XP_017701102.1| PREDICTED: uncharacterized protein LOC103718... 56 2e-06 ref|XP_008805859.1| PREDICTED: uncharacterized protein LOC103718... 56 2e-06 ref|XP_008805858.1| PREDICTED: uncharacterized protein LOC103718... 56 2e-06 ref|XP_017701101.1| PREDICTED: uncharacterized protein LOC103718... 56 2e-06 >ref|XP_019701891.1| PREDICTED: PHD finger protein EHD3-like isoform X5 [Elaeis guineensis] Length = 582 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 1 RRYEQWVLQQHGKKDVRQTNNEANRSMDVLLSAVEK 108 RRYEQW+LQ+H K DVRQ NEANRSMD+LLSA EK Sbjct: 534 RRYEQWILQRHRKNDVRQA-NEANRSMDLLLSAAEK 568 >ref|XP_019701890.1| PREDICTED: PHD finger protein EHD3-like isoform X4 [Elaeis guineensis] Length = 583 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 1 RRYEQWVLQQHGKKDVRQTNNEANRSMDVLLSAVEK 108 RRYEQW+LQ+H K DVRQ NEANRSMD+LLSA EK Sbjct: 535 RRYEQWILQRHRKNDVRQA-NEANRSMDLLLSAAEK 569 >ref|XP_019701888.1| PREDICTED: PHD finger protein EHD3-like isoform X3 [Elaeis guineensis] ref|XP_019701889.1| PREDICTED: PHD finger protein EHD3-like isoform X3 [Elaeis guineensis] Length = 715 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 1 RRYEQWVLQQHGKKDVRQTNNEANRSMDVLLSAVEK 108 RRYEQW+LQ+H K DVRQ NEANRSMD+LLSA EK Sbjct: 667 RRYEQWILQRHRKNDVRQA-NEANRSMDLLLSAAEK 701 >ref|XP_010905320.1| PREDICTED: PHD finger protein EHD3-like isoform X2 [Elaeis guineensis] Length = 741 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 1 RRYEQWVLQQHGKKDVRQTNNEANRSMDVLLSAVEK 108 RRYEQW+LQ+H K DVRQ NEANRSMD+LLSA EK Sbjct: 693 RRYEQWILQRHRKNDVRQA-NEANRSMDLLLSAAEK 727 >ref|XP_010905319.1| PREDICTED: PHD finger protein EHD3-like isoform X1 [Elaeis guineensis] Length = 742 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 1 RRYEQWVLQQHGKKDVRQTNNEANRSMDVLLSAVEK 108 RRYEQW+LQ+H K DVRQ NEANRSMD+LLSA EK Sbjct: 694 RRYEQWILQRHRKNDVRQA-NEANRSMDLLLSAAEK 728 >ref|XP_008783327.1| PREDICTED: uncharacterized protein LOC103702611 isoform X3 [Phoenix dactylifera] Length = 712 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 1 RRYEQWVLQQHGKKDVRQTNNEANRSMDVLLSAVEK 108 RRYEQW+LQQH K DVRQ +EANRSMD+LLSA EK Sbjct: 664 RRYEQWILQQHRKNDVRQA-SEANRSMDLLLSAAEK 698 >ref|XP_010911156.1| PREDICTED: PHD finger protein EHD3-like [Elaeis guineensis] Length = 740 Score = 57.4 bits (137), Expect = 6e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 1 RRYEQWVLQQHGKKDVRQTNNEANRSMDVLLSAVEK 108 RRYEQWVLQQH K DVRQ EANRSMD+LLSA EK Sbjct: 692 RRYEQWVLQQHRKNDVRQV-REANRSMDLLLSAAEK 726 >ref|XP_008783326.1| PREDICTED: uncharacterized protein LOC103702611 isoform X2 [Phoenix dactylifera] Length = 741 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 1 RRYEQWVLQQHGKKDVRQTNNEANRSMDVLLSAVEK 108 RRYEQW+LQQH K DVRQ +EANRSMD+LLSA EK Sbjct: 693 RRYEQWILQQHRKNDVRQA-SEANRSMDLLLSAAEK 727 >ref|XP_008783325.1| PREDICTED: uncharacterized protein LOC103702611 isoform X1 [Phoenix dactylifera] Length = 742 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 1 RRYEQWVLQQHGKKDVRQTNNEANRSMDVLLSAVEK 108 RRYEQW+LQQH K DVRQ +EANRSMD+LLSA EK Sbjct: 694 RRYEQWILQQHRKNDVRQA-SEANRSMDLLLSAAEK 728 >ref|XP_017701103.1| PREDICTED: uncharacterized protein LOC103718708 isoform X5 [Phoenix dactylifera] Length = 709 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 RRYEQWVLQQHGKKDVRQTNNEANRSMDVLLSAVEK 108 RRYEQW+LQ+H K DVRQ NEAN SMD+LLSA EK Sbjct: 661 RRYEQWILQRHRKNDVRQA-NEANESMDLLLSAAEK 695 >ref|XP_017701102.1| PREDICTED: uncharacterized protein LOC103718708 isoform X4 [Phoenix dactylifera] Length = 712 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 RRYEQWVLQQHGKKDVRQTNNEANRSMDVLLSAVEK 108 RRYEQW+LQ+H K DVRQ NEAN SMD+LLSA EK Sbjct: 664 RRYEQWILQRHRKNDVRQA-NEANESMDLLLSAAEK 698 >ref|XP_008805859.1| PREDICTED: uncharacterized protein LOC103718708 isoform X3 [Phoenix dactylifera] Length = 741 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 RRYEQWVLQQHGKKDVRQTNNEANRSMDVLLSAVEK 108 RRYEQW+LQ+H K DVRQ NEAN SMD+LLSA EK Sbjct: 693 RRYEQWILQRHRKNDVRQA-NEANESMDLLLSAAEK 727 >ref|XP_008805858.1| PREDICTED: uncharacterized protein LOC103718708 isoform X2 [Phoenix dactylifera] Length = 742 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 RRYEQWVLQQHGKKDVRQTNNEANRSMDVLLSAVEK 108 RRYEQW+LQ+H K DVRQ NEAN SMD+LLSA EK Sbjct: 694 RRYEQWILQRHRKNDVRQA-NEANESMDLLLSAAEK 728 >ref|XP_017701101.1| PREDICTED: uncharacterized protein LOC103718708 isoform X1 [Phoenix dactylifera] Length = 745 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 RRYEQWVLQQHGKKDVRQTNNEANRSMDVLLSAVEK 108 RRYEQW+LQ+H K DVRQ NEAN SMD+LLSA EK Sbjct: 697 RRYEQWILQRHRKNDVRQA-NEANESMDLLLSAAEK 731