BLASTX nr result
ID: Ophiopogon23_contig00018107
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00018107 (1963 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78693.1| hypothetical protein VITISV_039562 [Vitis vinifera] 82 8e-15 ref|XP_023882322.1| probable bifunctional methylthioribulose-1-p... 80 3e-14 ref|XP_008349993.1| PREDICTED: probable bifunctional methylthior... 81 3e-14 gb|PKI37645.1| hypothetical protein CRG98_041938, partial [Punic... 80 7e-14 ref|XP_017186340.1| PREDICTED: probable bifunctional methylthior... 81 5e-13 emb|CBI20280.3| unnamed protein product, partial [Vitis vinifera] 82 1e-12 gb|PRQ31231.1| putative phosphoric monoester hydrolase, Methylth... 82 1e-12 sp|E0CSI1.2|MTBC1_VITVI RecName: Full=Probable bifunctional meth... 82 1e-12 ref|XP_021833524.1| probable bifunctional methylthioribulose-1-p... 82 1e-12 ref|XP_024158785.1| LOW QUALITY PROTEIN: probable bifunctional m... 82 1e-12 ref|XP_021833523.1| probable bifunctional methylthioribulose-1-p... 82 1e-12 ref|XP_002285049.1| PREDICTED: probable bifunctional methylthior... 82 1e-12 gb|PNX87686.1| putative bifunctional methylthioribulose-1-phosph... 74 1e-12 ref|XP_007213919.1| probable bifunctional methylthioribulose-1-p... 82 1e-12 ref|XP_008779155.1| PREDICTED: probable bifunctional methylthior... 75 1e-12 ref|XP_020418576.1| probable bifunctional methylthioribulose-1-p... 82 1e-12 ref|XP_020418575.1| probable bifunctional methylthioribulose-1-p... 82 1e-12 ref|XP_020418574.1| probable bifunctional methylthioribulose-1-p... 82 1e-12 gb|ONI12711.1| hypothetical protein PRUPE_4G180000 [Prunus persica] 82 1e-12 gb|ONI12710.1| hypothetical protein PRUPE_4G180000 [Prunus persica] 82 2e-12 >emb|CAN78693.1| hypothetical protein VITISV_039562 [Vitis vinifera] Length = 145 Score = 82.4 bits (202), Expect = 8e-15 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC FYGLGWVSGTGGSIT KVHD+S+PKPQQLIVMSPSG Sbjct: 32 SDLCRHFYGLGWVSGTGGSITIKVHDESIPKPQQLIVMSPSG 73 >ref|XP_023882322.1| probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 [Quercus suber] gb|POE73285.1| putative bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase e1 [Quercus suber] Length = 128 Score = 80.5 bits (197), Expect = 3e-14 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC +FY LGWVSGTGGSIT KVHDDS+PKP QLIVMSPSG Sbjct: 35 SDLCRQFYNLGWVSGTGGSITIKVHDDSIPKPHQLIVMSPSG 76 >ref|XP_008349993.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1 [Malus domestica] Length = 144 Score = 80.9 bits (198), Expect = 3e-14 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC +FY LGWVSGTGGSIT KVHDDS+PKP+QL+VMSPSG Sbjct: 32 SDLCRQFYNLGWVSGTGGSITIKVHDDSIPKPEQLVVMSPSG 73 >gb|PKI37645.1| hypothetical protein CRG98_041938, partial [Punica granatum] Length = 158 Score = 80.1 bits (196), Expect = 7e-14 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC +FY LGWVSGTGGSIT KVHDDSVPKP QLIVMSPSG Sbjct: 40 SDLCRQFYTLGWVSGTGGSITIKVHDDSVPKPDQLIVMSPSG 81 >ref|XP_017186340.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 [Malus domestica] Length = 300 Score = 81.3 bits (199), Expect = 5e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC +FY LGWVSGTGGSIT KVHDDSVPKP+QL+VMSPSG Sbjct: 29 SDLCRQFYNLGWVSGTGGSITIKVHDDSVPKPEQLVVMSPSG 70 >emb|CBI20280.3| unnamed protein product, partial [Vitis vinifera] Length = 507 Score = 82.4 bits (202), Expect = 1e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC FYGLGWVSGTGGSIT KVHD+S+PKPQQLIVMSPSG Sbjct: 22 SDLCRHFYGLGWVSGTGGSITIKVHDESIPKPQQLIVMSPSG 63 >gb|PRQ31231.1| putative phosphoric monoester hydrolase, Methylthioribulose 1-phosphate dehydratase [Rosa chinensis] Length = 516 Score = 82.4 bits (202), Expect = 1e-12 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -2 Query: 1668 QPCEIDPVAGTDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 QP V +DLC +FY LGWVSGTGGSIT KVHD+SVPKPQQL++MSPSG Sbjct: 22 QPVNDTKVLISDLCRQFYNLGWVSGTGGSITIKVHDESVPKPQQLVIMSPSG 73 >sp|E0CSI1.2|MTBC1_VITVI RecName: Full=Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1; Includes: RecName: Full=Methylthioribulose-1-phosphate dehydratase; Short=MTRu-1-P dehydratase; Includes: RecName: Full=Enolase-phosphatase E1; AltName: Full=2,3-diketo-5-methylthio-1-phosphopentane phosphatase Length = 517 Score = 82.4 bits (202), Expect = 1e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC FYGLGWVSGTGGSIT KVHD+S+PKPQQLIVMSPSG Sbjct: 32 SDLCRHFYGLGWVSGTGGSITIKVHDESIPKPQQLIVMSPSG 73 >ref|XP_021833524.1| probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1 isoform X2 [Prunus avium] Length = 523 Score = 82.4 bits (202), Expect = 1e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC +FY LGWVSGTGGSIT KVHDDSVPKPQQL+VMSPSG Sbjct: 32 SDLCRQFYNLGWVSGTGGSITIKVHDDSVPKPQQLVVMSPSG 73 >ref|XP_024158785.1| LOW QUALITY PROTEIN: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1 [Rosa chinensis] Length = 538 Score = 82.4 bits (202), Expect = 1e-12 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -2 Query: 1668 QPCEIDPVAGTDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 QP V +DLC +FY LGWVSGTGGSIT KVHD+SVPKPQQL++MSPSG Sbjct: 22 QPVNDTKVLISDLCRQFYNLGWVSGTGGSITIKVHDESVPKPQQLVIMSPSG 73 >ref|XP_021833523.1| probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1 isoform X1 [Prunus avium] Length = 543 Score = 82.4 bits (202), Expect = 1e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC +FY LGWVSGTGGSIT KVHDDSVPKPQQL+VMSPSG Sbjct: 32 SDLCRQFYNLGWVSGTGGSITIKVHDDSVPKPQQLVVMSPSG 73 >ref|XP_002285049.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1 [Vitis vinifera] Length = 544 Score = 82.4 bits (202), Expect = 1e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC FYGLGWVSGTGGSIT KVHD+S+PKPQQLIVMSPSG Sbjct: 59 SDLCRHFYGLGWVSGTGGSITIKVHDESIPKPQQLIVMSPSG 100 >gb|PNX87686.1| putative bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase e1-like protein, partial [Trifolium pratense] Length = 74 Score = 73.9 bits (180), Expect = 1e-12 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -2 Query: 1635 DLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPS 1516 +LC FY LGWVSGTGGSI+ KVHDDS+PKPQQLI+MSPS Sbjct: 35 ELCRHFYTLGWVSGTGGSISIKVHDDSIPKPQQLILMSPS 74 >ref|XP_007213919.1| probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1 isoform X4 [Prunus persica] gb|ONI12714.1| hypothetical protein PRUPE_4G180000 [Prunus persica] gb|ONI12715.1| hypothetical protein PRUPE_4G180000 [Prunus persica] Length = 523 Score = 82.0 bits (201), Expect = 1e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC +FY LGWVSGTGGSIT KVHDDSVPKPQQL++MSPSG Sbjct: 32 SDLCRQFYNLGWVSGTGGSITIKVHDDSVPKPQQLVIMSPSG 73 >ref|XP_008779155.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1, partial [Phoenix dactylifera] Length = 115 Score = 75.1 bits (183), Expect = 1e-12 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 1635 DLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +LC FY GWV+GTGGSIT KVHDD+VPKP+QLIVMSPSG Sbjct: 30 ELCRHFYSFGWVTGTGGSITIKVHDDAVPKPEQLIVMSPSG 70 >ref|XP_020418576.1| probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1 isoform X3 [Prunus persica] Length = 527 Score = 82.0 bits (201), Expect = 1e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC +FY LGWVSGTGGSIT KVHDDSVPKPQQL++MSPSG Sbjct: 32 SDLCRQFYNLGWVSGTGGSITIKVHDDSVPKPQQLVIMSPSG 73 >ref|XP_020418575.1| probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1 isoform X2 [Prunus persica] gb|ONI12712.1| hypothetical protein PRUPE_4G180000 [Prunus persica] gb|ONI12713.1| hypothetical protein PRUPE_4G180000 [Prunus persica] Length = 543 Score = 82.0 bits (201), Expect = 1e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC +FY LGWVSGTGGSIT KVHDDSVPKPQQL++MSPSG Sbjct: 32 SDLCRQFYNLGWVSGTGGSITIKVHDDSVPKPQQLVIMSPSG 73 >ref|XP_020418574.1| probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1 isoform X1 [Prunus persica] Length = 547 Score = 82.0 bits (201), Expect = 1e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC +FY LGWVSGTGGSIT KVHDDSVPKPQQL++MSPSG Sbjct: 32 SDLCRQFYNLGWVSGTGGSITIKVHDDSVPKPQQLVIMSPSG 73 >gb|ONI12711.1| hypothetical protein PRUPE_4G180000 [Prunus persica] Length = 553 Score = 82.0 bits (201), Expect = 1e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC +FY LGWVSGTGGSIT KVHDDSVPKPQQL++MSPSG Sbjct: 62 SDLCRQFYNLGWVSGTGGSITIKVHDDSVPKPQQLVIMSPSG 103 >gb|ONI12710.1| hypothetical protein PRUPE_4G180000 [Prunus persica] Length = 573 Score = 82.0 bits (201), Expect = 2e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -2 Query: 1638 TDLCEEFYGLGWVSGTGGSITTKVHDDSVPKPQQLIVMSPSG 1513 +DLC +FY LGWVSGTGGSIT KVHDDSVPKPQQL++MSPSG Sbjct: 62 SDLCRQFYNLGWVSGTGGSITIKVHDDSVPKPQQLVIMSPSG 103