BLASTX nr result
ID: Ophiopogon23_contig00017915
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00017915 (566 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65391.1| uncharacterized protein A4U43_C07F36620 [Asparagu... 62 6e-08 >gb|ONK65391.1| uncharacterized protein A4U43_C07F36620 [Asparagus officinalis] Length = 292 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +3 Query: 294 PTWLDLLVPITELILERLPLPDYIRFGAVCRQWRSIQRSHR 416 P WLDL TELIL+RLPLPDYIRF VC +W+SIQ +HR Sbjct: 162 PPWLDLPDLATELILQRLPLPDYIRFADVCIKWQSIQNNHR 202