BLASTX nr result
ID: Ophiopogon23_contig00017904
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00017904 (359 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020704440.1| protein NRT1/ PTR FAMILY 3.1-like [Dendrobiu... 57 4e-07 dbj|GAV88555.1| PTR2 domain-containing protein [Cephalotus folli... 54 7e-06 gb|OMP06775.1| Proton-dependent oligopeptide transporter family ... 54 7e-06 >ref|XP_020704440.1| protein NRT1/ PTR FAMILY 3.1-like [Dendrobium catenatum] gb|PKU78174.1| putative nitrite transporter [Dendrobium catenatum] Length = 573 Score = 57.4 bits (137), Expect = 4e-07 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -1 Query: 359 WIVTGLQVLNLGYYVLCAKFYTLKAVQIRPRKGVGMQ 249 WI+TGLQVLNLGYYVLCA+FYT K +++R + VG++ Sbjct: 535 WIITGLQVLNLGYYVLCARFYTYKPLRVRDDELVGVE 571 >dbj|GAV88555.1| PTR2 domain-containing protein [Cephalotus follicularis] Length = 593 Score = 53.9 bits (128), Expect = 7e-06 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = -1 Query: 359 WIVTGLQVLNLGYYVLCAKFYTLKAVQIRPRKGVGMQDGSVELSK 225 W++TGLQ++NL YY++CAK YTLK +QI KG +DG VEL+K Sbjct: 549 WLITGLQLVNLIYYIVCAKMYTLKPIQIH-HKGSDSEDG-VELTK 591 >gb|OMP06775.1| Proton-dependent oligopeptide transporter family [Corchorus olitorius] Length = 601 Score = 53.9 bits (128), Expect = 7e-06 Identities = 23/45 (51%), Positives = 33/45 (73%) Frame = -1 Query: 359 WIVTGLQVLNLGYYVLCAKFYTLKAVQIRPRKGVGMQDGSVELSK 225 W++T LQV+N YY++CAKFYT K +Q + R+ +G +G VEL K Sbjct: 555 WLITCLQVMNFVYYLVCAKFYTSKPIQFQNREELGEPNGEVELVK 599