BLASTX nr result
ID: Ophiopogon23_contig00017709
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00017709 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264914.1| derlin-1 [Asparagus officinalis] >gi|1141988... 61 3e-08 >ref|XP_020264914.1| derlin-1 [Asparagus officinalis] gb|ONK69776.1| uncharacterized protein A4U43_C05F26600 [Asparagus officinalis] Length = 241 Score = 60.8 bits (146), Expect = 3e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 428 RWGIGMQTNSPVRPNTAASGGVFRGRSYRLN 336 RWG+G+QTN+P+RPNTAAS G FRGRSYRLN Sbjct: 210 RWGVGVQTNAPIRPNTAASTGAFRGRSYRLN 240