BLASTX nr result
ID: Ophiopogon23_contig00017646
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00017646 (363 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259174.1| zinc finger AN1 and C2H2 domain-containing s... 72 2e-12 >ref|XP_020259174.1| zinc finger AN1 and C2H2 domain-containing stress-associated protein 11 [Asparagus officinalis] Length = 293 Score = 71.6 bits (174), Expect = 2e-12 Identities = 37/60 (61%), Positives = 45/60 (75%), Gaps = 2/60 (3%) Frame = +2 Query: 2 KNCSLKVLLKH*FPSDHTCKPPMKISKH-HPLLLA-AREGMDCRDTKQKMPTSPPSVTAC 175 KNC + V LKH FPSDH CK +K KH HPLL + AR+ +CR+TKQKMPTSPP++ AC Sbjct: 236 KNCGIGVCLKHRFPSDHGCK--LKSFKHQHPLLSSIARKETNCRNTKQKMPTSPPTIEAC 293