BLASTX nr result
ID: Ophiopogon23_contig00017548
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00017548 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001156932.1| cytochrome c oxidase subunit 7C, mitochondri... 96 5e-23 gb|AAT92215.1| cytochrome oxidase subunit VIIc [Ixodes pacificus] 81 2e-17 ref|XP_022705689.1| cytochrome c oxidase subunit 7C, mitochondri... 78 3e-16 ref|XP_022670438.1| cytochrome c oxidase subunit 7C, mitochondri... 78 3e-16 gb|ODN01057.1| Cytochrome c oxidase subunit 7C, mitochondrial [O... 76 3e-15 gb|ACE75209.1| cytochrome c oxidase-like protein [Glyptapanteles... 74 9e-15 gb|OQR68243.1| Cytochrome c oxidase subunit 7C [Tropilaelaps mer... 73 3e-14 ref|XP_021920452.1| cytochrome c oxidase subunit 7C, mitochondri... 72 8e-14 ref|XP_022120961.1| cytochrome c oxidase subunit 7C, mitochondri... 71 2e-13 gb|PNF34381.1| Cytochrome c oxidase subunit 7C, mitochondrial [C... 71 2e-13 ref|XP_012254142.1| cytochrome c oxidase subunit 7C, mitochondri... 70 4e-13 ref|XP_002004766.1| uncharacterized protein Dmoj_GI20097, isofor... 69 1e-12 ref|XP_014287118.1| PREDICTED: cytochrome c oxidase subunit 7C, ... 69 1e-12 ref|XP_014295166.1| PREDICTED: cytochrome c oxidase subunit 7C, ... 69 2e-12 ref|XP_015509630.1| PREDICTED: cytochrome c oxidase subunit 7C, ... 69 2e-12 dbj|BAN21304.1| unkown protein [Riptortus pedestris] 68 2e-12 ref|XP_018425618.1| PREDICTED: cytochrome c oxidase subunit 7C, ... 68 3e-12 ref|XP_002063523.1| cytochrome c oxidase subunit 7C, mitochondri... 67 4e-12 gb|KMQ90353.1| cytochrome c oxidase subunit mitochondrial precur... 67 5e-12 dbj|GAU98340.1| hypothetical protein RvY_09499 [Ramazzottius var... 68 5e-12 >ref|NP_001156932.1| cytochrome c oxidase subunit 7C, mitochondrial [Nasonia vitripennis] Length = 72 Score = 95.5 bits (236), Expect = 5e-23 Identities = 43/71 (60%), Positives = 57/71 (80%) Frame = +3 Query: 114 LGRLARNIIPKRNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGL 293 L R++RNIIPKRNFM+SA+R+ +HD+GGEPGKNLPF + N+Y TLI T ++ + + Sbjct: 4 LQRISRNIIPKRNFMKSAIRKD--EHDLGGEPGKNLPFDIHNRYKFTLIYTAFISIGMAI 61 Query: 294 PFVAVRHQLLK 326 PF+AVRHQLLK Sbjct: 62 PFLAVRHQLLK 72 >gb|AAT92215.1| cytochrome oxidase subunit VIIc [Ixodes pacificus] Length = 73 Score = 81.3 bits (199), Expect = 2e-17 Identities = 38/72 (52%), Positives = 48/72 (66%), Gaps = 1/72 (1%) Frame = +3 Query: 114 LGRLARNIIPKRNFMQSAVRRGGHDH-DMGGEPGKNLPFSVKNKYVVTLIITCYVGSALG 290 + RL R + RNF SA+RR GHDH D GG PG NLPF + N++ +T+ + G+ G Sbjct: 1 MSRLTRLAVSARNFTTSAIRRSGHDHHDEGGIPGSNLPFKINNRFGLTIKFALFFGTGFG 60 Query: 291 LPFVAVRHQLLK 326 LPF AVRHQLLK Sbjct: 61 LPFFAVRHQLLK 72 >ref|XP_022705689.1| cytochrome c oxidase subunit 7C, mitochondrial-like [Varroa jacobsoni] Length = 75 Score = 78.2 bits (191), Expect = 3e-16 Identities = 37/69 (53%), Positives = 47/69 (68%) Frame = +3 Query: 120 RLARNIIPKRNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPF 299 RL ++ R+F S VR+GGH D GG PG NLPFS+KN Y +TL + + GSA +PF Sbjct: 5 RLRQSFQKARSFTTSTVRQGGHHDDYGGLPGDNLPFSIKNPYALTLKMVLFFGSAAAIPF 64 Query: 300 VAVRHQLLK 326 + VRHQLLK Sbjct: 65 LNVRHQLLK 73 >ref|XP_022670438.1| cytochrome c oxidase subunit 7C, mitochondrial-like [Varroa destructor] Length = 75 Score = 78.2 bits (191), Expect = 3e-16 Identities = 37/69 (53%), Positives = 47/69 (68%) Frame = +3 Query: 120 RLARNIIPKRNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPF 299 RL ++ R+F S VR+GGH D GG PG NLPFS+KN Y +TL + + GSA +PF Sbjct: 5 RLRQSFQSARSFTTSTVRQGGHHDDYGGLPGDNLPFSIKNPYALTLKMVLFFGSAAAIPF 64 Query: 300 VAVRHQLLK 326 + VRHQLLK Sbjct: 65 LNVRHQLLK 73 >gb|ODN01057.1| Cytochrome c oxidase subunit 7C, mitochondrial [Orchesella cincta] Length = 71 Score = 75.9 bits (185), Expect = 3e-15 Identities = 34/68 (50%), Positives = 47/68 (69%) Frame = +3 Query: 123 LARNIIPKRNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFV 302 +AR RNFM SA+RRGG HD+GG PG NLPF V+N++ + + + ++GS +PF+ Sbjct: 3 VARRAFQVRNFMTSALRRGGDHHDVGGVPGANLPFGVQNRWKLAVYMGAWLGSGFSVPFL 62 Query: 303 AVRHQLLK 326 VRHQL K Sbjct: 63 LVRHQLKK 70 >gb|ACE75209.1| cytochrome c oxidase-like protein [Glyptapanteles flavicoxis] Length = 66 Score = 74.3 bits (181), Expect = 9e-15 Identities = 36/60 (60%), Positives = 42/60 (70%) Frame = +3 Query: 147 RNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFVAVRHQLLK 326 RNF SA+RR GH D GG PG NLPFS+KN+Y +T + GS L LPFV VRHQ+LK Sbjct: 8 RNFTTSAIRRSGHG-DPGGYPGANLPFSIKNRYKLTAYFIFFFGSGLALPFVIVRHQMLK 66 >gb|OQR68243.1| Cytochrome c oxidase subunit 7C [Tropilaelaps mercedesae] Length = 75 Score = 73.2 bits (178), Expect = 3e-14 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = +3 Query: 147 RNFMQSAV-RRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFVAVRHQLL 323 R F SA+ R GGH D GG PG+NLPFSVKN+Y +TL + + GSA +PF+ VRHQL Sbjct: 11 RRFTTSAICRSGGHHDDYGGVPGENLPFSVKNRYALTLKMALFFGSAFSIPFLVVRHQLK 70 Query: 324 K 326 K Sbjct: 71 K 71 >ref|XP_021920452.1| cytochrome c oxidase subunit 7C, mitochondrial-like [Zootermopsis nevadensis] gb|KDR19224.1| Cytochrome c oxidase subunit 7C, mitochondrial [Zootermopsis nevadensis] Length = 69 Score = 72.0 bits (175), Expect = 8e-14 Identities = 32/60 (53%), Positives = 43/60 (71%) Frame = +3 Query: 147 RNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFVAVRHQLLK 326 RNF+ SA RR HDH GG PGKN+PF + N+Y +T++ + GS +G PF+ +RHQLLK Sbjct: 11 RNFITSASRRSEHDH--GGIPGKNIPFDISNRYKLTVLFIAFFGSGVGAPFMILRHQLLK 68 >ref|XP_022120961.1| cytochrome c oxidase subunit 7C, mitochondrial-like [Pieris rapae] Length = 69 Score = 71.2 bits (173), Expect = 2e-13 Identities = 33/71 (46%), Positives = 49/71 (69%) Frame = +3 Query: 114 LGRLARNIIPKRNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGL 293 LG + ++ I RN M++ +R G H GG PG+NLPF ++N++ +TL+ T ++GS LG Sbjct: 2 LGVVTKSNILGRNVMKTFIRNGSH----GGVPGENLPFDIQNRHKLTLLFTVFIGSGLGA 57 Query: 294 PFVAVRHQLLK 326 PF+ RHQLLK Sbjct: 58 PFLITRHQLLK 68 >gb|PNF34381.1| Cytochrome c oxidase subunit 7C, mitochondrial [Cryptotermes secundus] Length = 70 Score = 71.2 bits (173), Expect = 2e-13 Identities = 34/61 (55%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = +3 Query: 147 RNFMQSAVRR-GGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFVAVRHQLL 323 RNF+ SA RR GGHDH GG PG N+PF + N+Y +T + + GS LG PF+ +RHQLL Sbjct: 11 RNFVTSAARRSGGHDH--GGIPGGNIPFDISNRYKLTALFIVFFGSGLGAPFLVLRHQLL 68 Query: 324 K 326 K Sbjct: 69 K 69 >ref|XP_012254142.1| cytochrome c oxidase subunit 7C, mitochondrial-like [Athalia rosae] Length = 67 Score = 70.1 bits (170), Expect = 4e-13 Identities = 34/68 (50%), Positives = 46/68 (67%) Frame = +3 Query: 123 LARNIIPKRNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFV 302 L+R ++ RNFM SA+RR G D+ GG PG NLPF + N+Y +T Y GS + +P++ Sbjct: 2 LSRRLV--RNFMTSAIRRSGDDNH-GGVPGANLPFDIHNRYKLTAYFILYFGSGIAIPYL 58 Query: 303 AVRHQLLK 326 VRHQLLK Sbjct: 59 IVRHQLLK 66 >ref|XP_002004766.1| uncharacterized protein Dmoj_GI20097, isoform A [Drosophila mojavensis] ref|XP_015018836.1| uncharacterized protein Dmoj_GI20097, isoform B [Drosophila mojavensis] ref|XP_017865419.1| PREDICTED: cytochrome c oxidase subunit 7C, mitochondrial [Drosophila arizonae] ref|XP_017959055.1| PREDICTED: cytochrome c oxidase subunit 7C, mitochondrial [Drosophila navojoa] gb|EDW08701.1| uncharacterized protein Dmoj_GI20097, isoform A [Drosophila mojavensis] gb|KRG04232.1| uncharacterized protein Dmoj_GI20097, isoform B [Drosophila mojavensis] Length = 66 Score = 68.9 bits (167), Expect = 1e-12 Identities = 36/68 (52%), Positives = 44/68 (64%) Frame = +3 Query: 123 LARNIIPKRNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFV 302 L R+ + RNF QS VR GGH GG PG+NLPFS++NKY +T + T G PF+ Sbjct: 2 LGRSSVIARNFSQSMVRYGGH----GGIPGENLPFSLQNKYRITALFTVGCVLGFGAPFL 57 Query: 303 AVRHQLLK 326 VRHQLLK Sbjct: 58 IVRHQLLK 65 >ref|XP_014287118.1| PREDICTED: cytochrome c oxidase subunit 7C, mitochondrial-like [Halyomorpha halys] Length = 67 Score = 68.9 bits (167), Expect = 1e-12 Identities = 31/60 (51%), Positives = 42/60 (70%) Frame = +3 Query: 147 RNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFVAVRHQLLK 326 RNF SA+RRGGH GG PG+NLPFS+ N++ +T + + GS L PF+ +RHQ+LK Sbjct: 11 RNFTTSAIRRGGH----GGVPGENLPFSLDNRFKITALFIVFFGSGLAAPFLVLRHQMLK 66 >ref|XP_014295166.1| PREDICTED: cytochrome c oxidase subunit 7C, mitochondrial-like [Microplitis demolitor] ref|XP_014295167.1| PREDICTED: cytochrome c oxidase subunit 7C, mitochondrial-like [Microplitis demolitor] Length = 65 Score = 68.6 bits (166), Expect = 2e-12 Identities = 33/60 (55%), Positives = 41/60 (68%) Frame = +3 Query: 147 RNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFVAVRHQLLK 326 R F SAVRR +H+ GG PG NLPF +KNKY +T + GSAL LP++ VRHQ+LK Sbjct: 8 RRFTTSAVRRS--EHESGGIPGANLPFDIKNKYKLTAYFIMFFGSALALPWIIVRHQMLK 65 >ref|XP_015509630.1| PREDICTED: cytochrome c oxidase subunit 7C, mitochondrial-like [Neodiprion lecontei] Length = 68 Score = 68.6 bits (166), Expect = 2e-12 Identities = 33/68 (48%), Positives = 44/68 (64%) Frame = +3 Query: 123 LARNIIPKRNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFV 302 L+R I+ RNFM + RR G D GG PG NLPF + N+Y +T + G+ LG+P++ Sbjct: 2 LSRQIV--RNFMTTVARRSGADDFHGGVPGGNLPFGINNRYKLTAYFIFFFGTGLGVPYL 59 Query: 303 AVRHQLLK 326 VRHQLLK Sbjct: 60 LVRHQLLK 67 >dbj|BAN21304.1| unkown protein [Riptortus pedestris] Length = 67 Score = 68.2 bits (165), Expect = 2e-12 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = +3 Query: 147 RNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFVAVRHQLLK 326 R F SA+RRGGH GG PG+NLPFS+ N++ VT + + GS L PF+ +RHQ+LK Sbjct: 11 RQFTTSAIRRGGH----GGTPGENLPFSIDNRFKVTALFILFFGSGLAAPFLVLRHQMLK 66 >ref|XP_018425618.1| PREDICTED: cytochrome c oxidase subunit 7C, mitochondrial [Nanorana parkeri] Length = 64 Score = 67.8 bits (164), Expect = 3e-12 Identities = 33/60 (55%), Positives = 42/60 (70%) Frame = +3 Query: 147 RNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFVAVRHQLLK 326 R F SA+RRGGH G PGKN+PFSV+NK+ + ++T +VGS PF+ VRHQLLK Sbjct: 7 RRFTTSALRRGGH---YGEGPGKNMPFSVENKWKLLAVMTAFVGSGFTAPFLIVRHQLLK 63 >ref|XP_002063523.1| cytochrome c oxidase subunit 7C, mitochondrial [Drosophila willistoni] gb|EDW74509.1| uncharacterized protein Dwil_GK21957 [Drosophila willistoni] Length = 66 Score = 67.4 bits (163), Expect = 4e-12 Identities = 36/68 (52%), Positives = 43/68 (63%) Frame = +3 Query: 123 LARNIIPKRNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFV 302 L R+ + RNF QS VR GH GG PG+NLPFS++NKY VT + T G PF+ Sbjct: 2 LGRSSVIARNFSQSMVRFSGH----GGVPGENLPFSIQNKYRVTALFTIGCVLGFGSPFL 57 Query: 303 AVRHQLLK 326 VRHQLLK Sbjct: 58 IVRHQLLK 65 >gb|KMQ90353.1| cytochrome c oxidase subunit mitochondrial precursor [Lasius niger] Length = 73 Score = 67.4 bits (163), Expect = 5e-12 Identities = 29/60 (48%), Positives = 39/60 (65%) Frame = +3 Query: 147 RNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFVAVRHQLLK 326 R FM SA+RRGGH G PG NLPFS +N++ + + + GS +PF+ +RHQLLK Sbjct: 14 RRFMTSAIRRGGHHDPYDGVPGYNLPFSTQNRHKLLALFMVFCGSGFSIPFLVIRHQLLK 73 >dbj|GAU98340.1| hypothetical protein RvY_09499 [Ramazzottius varieornatus] Length = 88 Score = 67.8 bits (164), Expect = 5e-12 Identities = 34/61 (55%), Positives = 39/61 (63%) Frame = +3 Query: 144 KRNFMQSAVRRGGHDHDMGGEPGKNLPFSVKNKYVVTLIITCYVGSALGLPFVAVRHQLL 323 KR F S R G DHD GG G NLPF + N+Y TL+ T + GS GLPF+ VRHQLL Sbjct: 19 KRQFSTSKKRLSG-DHDDGGIVGGNLPFDIHNRYKFTLLFTAFFGSGFGLPFLVVRHQLL 77 Query: 324 K 326 K Sbjct: 78 K 78