BLASTX nr result
ID: Ophiopogon23_contig00017419
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00017419 (441 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020704386.1| cytochrome c biogenesis protein CCS1, chloro... 61 5e-08 ref|XP_020256395.1| cytochrome c biogenesis protein CCS1, chloro... 60 1e-07 gb|ONK74589.1| uncharacterized protein A4U43_C03F8050 [Asparagus... 60 2e-07 ref|XP_004981617.1| cytochrome c biogenesis protein CCS1, chloro... 57 1e-06 gb|OEL35372.1| Cytochrome c biogenesis protein CCS1, chloroplast... 57 1e-06 gb|PAN44806.1| hypothetical protein PAHAL_I01556 [Panicum hallii] 57 1e-06 gb|PKA57052.1| Cytochrome c biogenesis protein CCS1, chloroplast... 57 1e-06 ref|XP_021813420.1| cytochrome c biogenesis protein CCS1, chloro... 57 1e-06 gb|OAY85929.1| Cytochrome c biogenesis protein CCS1, chloroplast... 57 2e-06 ref|XP_020096120.1| cytochrome c biogenesis protein CCS1, chloro... 57 2e-06 ref|XP_022749137.1| cytochrome c biogenesis protein CCS1, chloro... 56 3e-06 ref|XP_022763571.1| cytochrome c biogenesis protein CCS1, chloro... 56 3e-06 ref|XP_022749136.1| cytochrome c biogenesis protein CCS1, chloro... 56 3e-06 ref|XP_012480105.1| PREDICTED: cytochrome c biogenesis protein C... 56 3e-06 ref|XP_022763570.1| cytochrome c biogenesis protein CCS1, chloro... 56 3e-06 dbj|GAU31687.1| hypothetical protein TSUD_63210, partial [Trifol... 55 4e-06 gb|KMZ56948.1| Cytochrome c biogenesis protein CCS1, chloroplast... 55 5e-06 gb|PNY08490.1| cytochrome c biogenesis protein CCS1 chloroplasti... 55 5e-06 ref|XP_014493884.2| cytochrome c biogenesis protein CCS1, chloro... 55 6e-06 gb|PKI47526.1| hypothetical protein CRG98_032116 [Punica granatum] 52 9e-06 >ref|XP_020704386.1| cytochrome c biogenesis protein CCS1, chloroplastic [Dendrobium catenatum] gb|PKU65808.1| Cytochrome c biogenesis protein CCS1, chloroplastic [Dendrobium catenatum] Length = 574 Score = 61.2 bits (147), Expect = 5e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELVGNNDALKN 331 VVVGGKTNRAKLEFP EMNCLLDKVPELV ++ N Sbjct: 538 VVVGGKTNRAKLEFPDEMNCLLDKVPELVDADEKKNN 574 >ref|XP_020256395.1| cytochrome c biogenesis protein CCS1, chloroplastic [Asparagus officinalis] Length = 389 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELVGNNDAL 337 VV+GGKTNRAKLEFP EMN LLD+VPELVG++D++ Sbjct: 353 VVIGGKTNRAKLEFPDEMNRLLDEVPELVGSSDSV 387 >gb|ONK74589.1| uncharacterized protein A4U43_C03F8050 [Asparagus officinalis] Length = 500 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELVGNNDAL 337 VV+GGKTNRAKLEFP EMN LLD+VPELVG++D++ Sbjct: 464 VVIGGKTNRAKLEFPDEMNRLLDEVPELVGSSDSV 498 >ref|XP_004981617.1| cytochrome c biogenesis protein CCS1, chloroplastic [Setaria italica] gb|KQK86914.1| hypothetical protein SETIT_034936mg [Setaria italica] Length = 566 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELVGNND 343 VVVGGKTNRAKLEF +EMN LLDKVPEL+G N+ Sbjct: 524 VVVGGKTNRAKLEFSEEMNRLLDKVPELIGANE 556 >gb|OEL35372.1| Cytochrome c biogenesis protein CCS1, chloroplastic [Dichanthelium oligosanthes] Length = 508 Score = 57.0 bits (136), Expect = 1e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELVGNND 343 VVVGGKTNRAKLEF +EMN LLDKVPEL+G N+ Sbjct: 465 VVVGGKTNRAKLEFSEEMNRLLDKVPELIGANN 497 >gb|PAN44806.1| hypothetical protein PAHAL_I01556 [Panicum hallii] Length = 562 Score = 57.0 bits (136), Expect = 1e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELVGNND 343 VVVGGKTNRAKLEF +EMN LLDKVPEL+G N+ Sbjct: 519 VVVGGKTNRAKLEFSEEMNRLLDKVPELIGANN 551 >gb|PKA57052.1| Cytochrome c biogenesis protein CCS1, chloroplastic [Apostasia shenzhenica] Length = 569 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELVGNNDAL 337 VV+GGKTNRAKLEFP EMN LLD+VPELVG ++++ Sbjct: 532 VVIGGKTNRAKLEFPAEMNRLLDRVPELVGADNSM 566 >ref|XP_021813420.1| cytochrome c biogenesis protein CCS1, chloroplastic [Prunus avium] Length = 569 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELVGNN 346 V+VGGKTNRAK EFP+EMNCLLD+VPELV ++ Sbjct: 528 VIVGGKTNRAKGEFPEEMNCLLDRVPELVNSS 559 >gb|OAY85929.1| Cytochrome c biogenesis protein CCS1, chloroplastic [Ananas comosus] Length = 557 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELVGNND 343 VVVG KTNRAKLEF QEMN LLDKVPEL+G++D Sbjct: 521 VVVGAKTNRAKLEFNQEMNRLLDKVPELIGSDD 553 >ref|XP_020096120.1| cytochrome c biogenesis protein CCS1, chloroplastic [Ananas comosus] Length = 558 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELVGNND 343 VVVG KTNRAKLEF QEMN LLDKVPEL+G++D Sbjct: 522 VVVGAKTNRAKLEFNQEMNRLLDKVPELIGSDD 554 >ref|XP_022749137.1| cytochrome c biogenesis protein CCS1, chloroplastic-like isoform X2 [Durio zibethinus] Length = 504 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELV 355 V+VGGKTNRAK EFP EMNCLLD+VPE+V Sbjct: 463 VIVGGKTNRAKAEFPDEMNCLLDRVPEIV 491 >ref|XP_022763571.1| cytochrome c biogenesis protein CCS1, chloroplastic-like isoform X2 [Durio zibethinus] Length = 548 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELV 355 V+VGGKTNRAK EFP EMNCLLD+VPE+V Sbjct: 507 VIVGGKTNRAKAEFPDEMNCLLDRVPEIV 535 >ref|XP_022749136.1| cytochrome c biogenesis protein CCS1, chloroplastic-like isoform X1 [Durio zibethinus] Length = 548 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELV 355 V+VGGKTNRAK EFP EMNCLLD+VPE+V Sbjct: 507 VIVGGKTNRAKAEFPDEMNCLLDRVPEIV 535 >ref|XP_012480105.1| PREDICTED: cytochrome c biogenesis protein CCS1, chloroplastic [Gossypium raimondii] gb|KJB32196.1| hypothetical protein B456_005G229000 [Gossypium raimondii] Length = 548 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELVGNNDALK 334 V+VGGKTNRAK EFP EMNCLLD+VPE+V ++ + K Sbjct: 507 VIVGGKTNRAKAEFPDEMNCLLDQVPEIVESSISKK 542 >ref|XP_022763570.1| cytochrome c biogenesis protein CCS1, chloroplastic-like isoform X1 [Durio zibethinus] Length = 556 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELV 355 V+VGGKTNRAK EFP EMNCLLD+VPE+V Sbjct: 515 VIVGGKTNRAKAEFPDEMNCLLDRVPEIV 543 >dbj|GAU31687.1| hypothetical protein TSUD_63210, partial [Trifolium subterraneum] Length = 418 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELVGNNDALK 334 VV+GGKTNRAKLEFP EMN LLDK+PE+V ++ K Sbjct: 378 VVIGGKTNRAKLEFPDEMNLLLDKIPEIVESSSLSK 413 >gb|KMZ56948.1| Cytochrome c biogenesis protein CCS1, chloroplastic [Zostera marina] Length = 542 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELVG 352 VV+GGKTNRAKLEFP EMN +LD+VPELVG Sbjct: 505 VVIGGKTNRAKLEFPDEMNRMLDRVPELVG 534 >gb|PNY08490.1| cytochrome c biogenesis protein CCS1 chloroplastic-like [Trifolium pratense] Length = 557 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELVGNNDALK 334 VV+GGKTNRAKLEFP EMN LLDK+PE+V ++ K Sbjct: 515 VVIGGKTNRAKLEFPDEMNLLLDKIPEIVESSSLSK 550 >ref|XP_014493884.2| cytochrome c biogenesis protein CCS1, chloroplastic [Vigna radiata var. radiata] ref|XP_022633981.1| cytochrome c biogenesis protein CCS1, chloroplastic [Vigna radiata var. radiata] Length = 595 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELV 355 VV+GGKTNRAK+EFP+EMN LLDKVPE+V Sbjct: 554 VVIGGKTNRAKMEFPEEMNLLLDKVPEIV 582 >gb|PKI47526.1| hypothetical protein CRG98_032116 [Punica granatum] Length = 129 Score = 52.4 bits (124), Expect = 9e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 441 VVVGGKTNRAKLEFPQEMNCLLDKVPELV 355 VVVGGKTNRAK EFP+EMN LLD+VPE+V Sbjct: 89 VVVGGKTNRAKAEFPEEMNRLLDRVPEIV 117