BLASTX nr result
ID: Ophiopogon23_contig00017411
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00017411 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261967.1| pentatricopeptide repeat-containing protein ... 70 3e-15 ref|XP_020261968.1| pentatricopeptide repeat-containing protein ... 70 3e-15 ref|XP_020261969.1| pentatricopeptide repeat-containing protein ... 70 3e-15 ref|XP_020261970.1| pentatricopeptide repeat-containing protein ... 70 3e-15 gb|ONK73160.1| uncharacterized protein A4U43_C04F27890 [Asparagu... 70 3e-15 gb|ONK80386.1| uncharacterized protein A4U43_C01F17100 [Asparagu... 71 8e-12 ref|XP_020246789.1| cell division cycle 20.2, cofactor of APC co... 71 8e-12 ref|XP_020260680.1| cell division cycle 20.2, cofactor of APC co... 70 3e-11 ref|XP_020589796.1| cell division cycle 20.2, cofactor of APC co... 69 5e-11 gb|OWM77454.1| hypothetical protein CDL15_Pgr016851 [Punica gran... 55 9e-11 ref|XP_022930981.1| cell division cycle 20.2, cofactor of APC co... 60 9e-11 gb|PKI51219.1| hypothetical protein CRG98_028367 [Punica granatum] 55 9e-11 ref|XP_019707966.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-10 ref|XP_023532087.1| cell division cycle 20.2, cofactor of APC co... 59 1e-10 ref|XP_022995478.1| cell division cycle 20.2, cofactor of APC co... 59 1e-10 gb|PKI39478.1| hypothetical protein CRG98_040154, partial [Punic... 66 1e-10 gb|PIN03640.1| Anaphase promoting complex, Cdc20, Cdh1, and Ama1... 67 2e-10 ref|XP_020247900.1| cell division cycle 20.2, cofactor of APC co... 67 2e-10 ref|XP_008800021.1| PREDICTED: cell division cycle 20.2, cofacto... 67 2e-10 dbj|GAV89899.1| WD40 domain-containing protein [Cephalotus folli... 57 2e-10 >ref|XP_020261967.1| pentatricopeptide repeat-containing protein At1g71490 isoform X1 [Asparagus officinalis] Length = 800 Score = 69.7 bits (169), Expect(2) = 3e-15 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +2 Query: 2 AEKFIDRMGFEPSKAMLATLVRACRVHGNREIGERATKRLLEI 130 AE+FID+M FEPS A+LATL+RACR HG++EIGERA KRLLE+ Sbjct: 694 AEEFIDQMPFEPSTAVLATLIRACRAHGSKEIGERAAKRLLEM 736 Score = 39.3 bits (90), Expect(2) = 3e-15 Identities = 22/50 (44%), Positives = 30/50 (60%) Frame = +1 Query: 130 TLDDPNHYALVADMFAYYRNQEELTWLMTIISIFSIGVSNDVLSIALGNL 279 T DDPNHY L+A+MFAY N E+L + ++ +G+ L I LG L Sbjct: 737 TSDDPNHYVLIANMFAYCGNWEQLMKVRAVMK--DMGIVE--LHILLGGL 782 >ref|XP_020261968.1| pentatricopeptide repeat-containing protein At1g71490 isoform X2 [Asparagus officinalis] Length = 755 Score = 69.7 bits (169), Expect(2) = 3e-15 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +2 Query: 2 AEKFIDRMGFEPSKAMLATLVRACRVHGNREIGERATKRLLEI 130 AE+FID+M FEPS A+LATL+RACR HG++EIGERA KRLLE+ Sbjct: 649 AEEFIDQMPFEPSTAVLATLIRACRAHGSKEIGERAAKRLLEM 691 Score = 39.3 bits (90), Expect(2) = 3e-15 Identities = 22/50 (44%), Positives = 30/50 (60%) Frame = +1 Query: 130 TLDDPNHYALVADMFAYYRNQEELTWLMTIISIFSIGVSNDVLSIALGNL 279 T DDPNHY L+A+MFAY N E+L + ++ +G+ L I LG L Sbjct: 692 TSDDPNHYVLIANMFAYCGNWEQLMKVRAVMK--DMGIVE--LHILLGGL 737 >ref|XP_020261969.1| pentatricopeptide repeat-containing protein At1g71490 isoform X3 [Asparagus officinalis] Length = 744 Score = 69.7 bits (169), Expect(2) = 3e-15 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +2 Query: 2 AEKFIDRMGFEPSKAMLATLVRACRVHGNREIGERATKRLLEI 130 AE+FID+M FEPS A+LATL+RACR HG++EIGERA KRLLE+ Sbjct: 638 AEEFIDQMPFEPSTAVLATLIRACRAHGSKEIGERAAKRLLEM 680 Score = 39.3 bits (90), Expect(2) = 3e-15 Identities = 22/50 (44%), Positives = 30/50 (60%) Frame = +1 Query: 130 TLDDPNHYALVADMFAYYRNQEELTWLMTIISIFSIGVSNDVLSIALGNL 279 T DDPNHY L+A+MFAY N E+L + ++ +G+ L I LG L Sbjct: 681 TSDDPNHYVLIANMFAYCGNWEQLMKVRAVMK--DMGIVE--LHILLGGL 726 >ref|XP_020261970.1| pentatricopeptide repeat-containing protein At1g71490 isoform X4 [Asparagus officinalis] Length = 626 Score = 69.7 bits (169), Expect(2) = 3e-15 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +2 Query: 2 AEKFIDRMGFEPSKAMLATLVRACRVHGNREIGERATKRLLEI 130 AE+FID+M FEPS A+LATL+RACR HG++EIGERA KRLLE+ Sbjct: 520 AEEFIDQMPFEPSTAVLATLIRACRAHGSKEIGERAAKRLLEM 562 Score = 39.3 bits (90), Expect(2) = 3e-15 Identities = 22/50 (44%), Positives = 30/50 (60%) Frame = +1 Query: 130 TLDDPNHYALVADMFAYYRNQEELTWLMTIISIFSIGVSNDVLSIALGNL 279 T DDPNHY L+A+MFAY N E+L + ++ +G+ L I LG L Sbjct: 563 TSDDPNHYVLIANMFAYCGNWEQLMKVRAVMK--DMGIVE--LHILLGGL 608 >gb|ONK73160.1| uncharacterized protein A4U43_C04F27890 [Asparagus officinalis] Length = 272 Score = 69.7 bits (169), Expect(2) = 3e-15 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +2 Query: 2 AEKFIDRMGFEPSKAMLATLVRACRVHGNREIGERATKRLLEI 130 AE+FID+M FEPS A+LATL+RACR HG++EIGERA KRLLE+ Sbjct: 166 AEEFIDQMPFEPSTAVLATLIRACRAHGSKEIGERAAKRLLEM 208 Score = 39.3 bits (90), Expect(2) = 3e-15 Identities = 22/50 (44%), Positives = 30/50 (60%) Frame = +1 Query: 130 TLDDPNHYALVADMFAYYRNQEELTWLMTIISIFSIGVSNDVLSIALGNL 279 T DDPNHY L+A+MFAY N E+L + ++ +G+ L I LG L Sbjct: 209 TSDDPNHYVLIANMFAYCGNWEQLMKVRAVMK--DMGIVE--LHILLGGL 254 >gb|ONK80386.1| uncharacterized protein A4U43_C01F17100 [Asparagus officinalis] Length = 472 Score = 71.2 bits (173), Expect = 8e-12 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +1 Query: 244 SNDVLSIALGNLINLWSTSNGFASELVTIDEDIGPVTSVCWAP 372 S++VLSIALGN + LW+ SNG ASELVTIDED+GPVTSV WAP Sbjct: 171 SSNVLSIALGNTVYLWNASNGSASELVTIDEDVGPVTSVSWAP 213 >ref|XP_020246789.1| cell division cycle 20.2, cofactor of APC complex-like [Asparagus officinalis] Length = 478 Score = 71.2 bits (173), Expect = 8e-12 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +1 Query: 244 SNDVLSIALGNLINLWSTSNGFASELVTIDEDIGPVTSVCWAP 372 S++VLSIALGN + LW+ SNG ASELVTIDED+GPVTSV WAP Sbjct: 171 SSNVLSIALGNTVYLWNASNGSASELVTIDEDVGPVTSVSWAP 213 >ref|XP_020260680.1| cell division cycle 20.2, cofactor of APC complex-like [Asparagus officinalis] gb|ONK71590.1| uncharacterized protein A4U43_C04F10260 [Asparagus officinalis] Length = 480 Score = 69.7 bits (169), Expect = 3e-11 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +1 Query: 244 SNDVLSIALGNLINLWSTSNGFASELVTIDEDIGPVTSVCWAP 372 S++VLSIALGN + LW+ SNG SELVTIDED+GPVTSV WAP Sbjct: 171 SSNVLSIALGNTVYLWNASNGSTSELVTIDEDVGPVTSVSWAP 213 >ref|XP_020589796.1| cell division cycle 20.2, cofactor of APC complex-like [Phalaenopsis equestris] Length = 480 Score = 68.9 bits (167), Expect = 5e-11 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +1 Query: 244 SNDVLSIALGNLINLWSTSNGFASELVTIDEDIGPVTSVCWAP 372 S +VLSIALGN + LW+ S G SELVT+D+D+GPVTSVCWAP Sbjct: 167 SRNVLSIALGNTVYLWNASQGSTSELVTVDDDLGPVTSVCWAP 209 >gb|OWM77454.1| hypothetical protein CDL15_Pgr016851 [Punica granatum] Length = 460 Score = 55.5 bits (132), Expect(2) = 9e-11 Identities = 23/40 (57%), Positives = 34/40 (85%) Frame = +1 Query: 250 DVLSIALGNLINLWSTSNGFASELVTIDEDIGPVTSVCWA 369 +VL++ALG+ + LW+ S+G SELVT++++IGPVTSV WA Sbjct: 158 NVLAVALGSTVYLWNVSSGSTSELVTVEDEIGPVTSVSWA 197 Score = 38.5 bits (88), Expect(2) = 9e-11 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = +3 Query: 201 DLVDDYHLNLLDWGEQRCVVNCLG 272 DLVDDYHLNLLDWG + LG Sbjct: 142 DLVDDYHLNLLDWGNANVLAVALG 165 >ref|XP_022930981.1| cell division cycle 20.2, cofactor of APC complex-like [Cucurbita moschata] Length = 453 Score = 59.7 bits (143), Expect(2) = 9e-11 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = +1 Query: 244 SNDVLSIALGNLINLWSTSNGFASELVTIDEDIGPVTSVCWAP 372 S++VL+IAL N + LW+ ++G SELVTID+++GPVTSV WAP Sbjct: 146 SSNVLAIALSNTVYLWNANDGSTSELVTIDDEVGPVTSVNWAP 188 Score = 34.3 bits (77), Expect(2) = 9e-11 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +3 Query: 201 DLVDDYHLNLLDWGEQRCVVNCL 269 DLVDDY+LNLLDWG + L Sbjct: 132 DLVDDYYLNLLDWGSSNVLAIAL 154 >gb|PKI51219.1| hypothetical protein CRG98_028367 [Punica granatum] Length = 367 Score = 55.5 bits (132), Expect(2) = 9e-11 Identities = 23/40 (57%), Positives = 34/40 (85%) Frame = +1 Query: 250 DVLSIALGNLINLWSTSNGFASELVTIDEDIGPVTSVCWA 369 +VL++ALG+ + LW+ S+G SELVT++++IGPVTSV WA Sbjct: 65 NVLAVALGSTVYLWNVSSGSTSELVTVEDEIGPVTSVSWA 104 Score = 38.5 bits (88), Expect(2) = 9e-11 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = +3 Query: 201 DLVDDYHLNLLDWGEQRCVVNCLG 272 DLVDDYHLNLLDWG + LG Sbjct: 49 DLVDDYHLNLLDWGNANVLAVALG 72 >ref|XP_019707966.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71490-like [Elaeis guineensis] ref|XP_019707967.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71490-like [Elaeis guineensis] ref|XP_019707968.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71490-like [Elaeis guineensis] Length = 719 Score = 64.7 bits (156), Expect(2) = 1e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +2 Query: 2 AEKFIDRMGFEPSKAMLATLVRACRVHGNREIGERATKRLLEI 130 AEK ID+M +PS AMLATLV ACR+HGN EIGERA K+LLE+ Sbjct: 581 AEKIIDQMPLQPSAAMLATLVEACRLHGNIEIGERAAKKLLEM 623 Score = 28.9 bits (63), Expect(2) = 1e-10 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 136 DDPNHYALVADMFAYYRNQEELTWLMTIISIFSIGVSNDVLSIALGN 276 D+P+HY L+A+M+A R EL + ++ I + + LGN Sbjct: 626 DNPSHYVLIANMYASARCWHELAKVRILMRDMGIQKAPSCSWLDLGN 672 >ref|XP_023532087.1| cell division cycle 20.2, cofactor of APC complex-like [Cucurbita pepo subsp. pepo] Length = 453 Score = 59.3 bits (142), Expect(2) = 1e-10 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = +1 Query: 244 SNDVLSIALGNLINLWSTSNGFASELVTIDEDIGPVTSVCWAP 372 S++VL+IAL N + LW+ ++G SELVT+D+++GPVTSV WAP Sbjct: 146 SSNVLAIALSNTVYLWNATDGSTSELVTVDDEVGPVTSVNWAP 188 Score = 34.3 bits (77), Expect(2) = 1e-10 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +3 Query: 201 DLVDDYHLNLLDWGEQRCVVNCL 269 DLVDDY+LNLLDWG + L Sbjct: 132 DLVDDYYLNLLDWGSSNVLAIAL 154 >ref|XP_022995478.1| cell division cycle 20.2, cofactor of APC complex-like [Cucurbita maxima] Length = 453 Score = 59.3 bits (142), Expect(2) = 1e-10 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = +1 Query: 244 SNDVLSIALGNLINLWSTSNGFASELVTIDEDIGPVTSVCWAP 372 S++VL+IAL N + LW+ ++G SELVT+D+++GPVTSV WAP Sbjct: 146 SSNVLAIALSNTVYLWNANDGSTSELVTVDDEVGPVTSVNWAP 188 Score = 34.3 bits (77), Expect(2) = 1e-10 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +3 Query: 201 DLVDDYHLNLLDWGEQRCVVNCL 269 DLVDDY+LNLLDWG + L Sbjct: 132 DLVDDYYLNLLDWGSSNVLAIAL 154 >gb|PKI39478.1| hypothetical protein CRG98_040154, partial [Punica granatum] Length = 216 Score = 66.2 bits (160), Expect = 1e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +1 Query: 244 SNDVLSIALGNLINLWSTSNGFASELVTIDEDIGPVTSVCWAP 372 S++VLSIALG+ + LW SNG SELVT+D+DIGPVTSV WAP Sbjct: 150 SSNVLSIALGSTVYLWDASNGSTSELVTVDDDIGPVTSVSWAP 192 >gb|PIN03640.1| Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Handroanthus impetiginosus] Length = 453 Score = 67.4 bits (163), Expect = 2e-10 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 244 SNDVLSIALGNLINLWSTSNGFASELVTIDEDIGPVTSVCWAP 372 S++VLSIALGN + LW SNG SELVTIDE+IGPVTSV WAP Sbjct: 146 SSNVLSIALGNTVYLWDASNGSTSELVTIDEEIGPVTSVKWAP 188 >ref|XP_020247900.1| cell division cycle 20.2, cofactor of APC complex-like [Asparagus officinalis] Length = 470 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +1 Query: 244 SNDVLSIALGNLINLWSTSNGFASELVTIDEDIGPVTSVCWAP 372 S++VLS+ALGN + LW+ SN ASELVTIDED+GPVTSV WAP Sbjct: 161 SSNVLSLALGNTVYLWNASNESASELVTIDEDVGPVTSVSWAP 203 >ref|XP_008800021.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like [Phoenix dactylifera] ref|XP_008800022.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like [Phoenix dactylifera] Length = 474 Score = 67.4 bits (163), Expect = 2e-10 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = +1 Query: 244 SNDVLSIALGNLINLWSTSNGFASELVTIDEDIGPVTSVCWAP 372 S++VLSIALGN + LW+ S+G SELVT+DED+GPVTSV WAP Sbjct: 165 SSNVLSIALGNTVYLWNASDGSTSELVTVDEDVGPVTSVSWAP 207 >dbj|GAV89899.1| WD40 domain-containing protein [Cephalotus follicularis] Length = 421 Score = 56.6 bits (135), Expect(2) = 2e-10 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +1 Query: 250 DVLSIALGNLINLWSTSNGFASELVTIDEDIGPVTSVCWAP 372 +VL+IALG+ + LW S+G SELVTI+E+ GPVTSV WAP Sbjct: 150 NVLAIALGSTVYLWDASDGSTSELVTINEEHGPVTSVSWAP 190 Score = 36.2 bits (82), Expect(2) = 2e-10 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +3 Query: 201 DLVDDYHLNLLDWGEQRCVVNCLG 272 DLVDDY+LNLLDWG + LG Sbjct: 134 DLVDDYYLNLLDWGNANVLAIALG 157