BLASTX nr result
ID: Ophiopogon23_contig00017282
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00017282 (522 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL69377.1|AF462214_1 putative asparaginyl endopeptidase, par... 55 2e-06 >gb|AAL69377.1|AF462214_1 putative asparaginyl endopeptidase, partial [Narcissus pseudonarcissus] Length = 149 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/38 (71%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = -2 Query: 518 EVLKTVRPAGQPLVDDWDCLKSMV-SVESYTTFFLNYG 408 EV+KTVRPAGQPLVDDWDCLKSMV S E++ YG Sbjct: 85 EVMKTVRPAGQPLVDDWDCLKSMVRSFEAHCGSLSQYG 122