BLASTX nr result
ID: Ophiopogon23_contig00016690
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00016690 (747 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008466970.1| PREDICTED: coiled-coil domain-containing pro... 57 1e-06 gb|ACJ83312.1| unknown [Medicago truncatula] 57 1e-06 ref|XP_008803163.1| PREDICTED: coiled-coil domain-containing pro... 59 2e-06 ref|XP_008803162.1| PREDICTED: coiled-coil domain-containing pro... 59 2e-06 ref|XP_001781100.1| predicted protein [Physcomitrella patens] 58 2e-06 ref|XP_009392910.1| PREDICTED: pre-mRNA-splicing factor cwf16 [M... 59 3e-06 ref|XP_008803164.1| PREDICTED: coiled-coil domain-containing pro... 59 3e-06 ref|XP_008803161.1| PREDICTED: coiled-coil domain-containing pro... 59 3e-06 ref|XP_010942888.1| PREDICTED: coiled-coil domain-containing pro... 59 3e-06 ref|XP_020102400.1| coiled-coil domain-containing protein 94 [An... 59 3e-06 gb|OAY65389.1| Coiled-coil domain-containing protein [Ananas com... 59 3e-06 gb|PKI47645.1| hypothetical protein CRG98_031931 [Punica granatum] 58 3e-06 emb|CBI14833.3| unnamed protein product, partial [Vitis vinifera] 57 3e-06 gb|OWM81028.1| hypothetical protein CDL15_Pgr007059 [Punica gran... 58 3e-06 ref|XP_019074265.1| PREDICTED: coiled-coil domain-containing pro... 57 4e-06 ref|XP_003635597.1| PREDICTED: coiled-coil domain-containing pro... 57 4e-06 gb|PNR29355.1| hypothetical protein PHYPA_028048 [Physcomitrella... 58 4e-06 gb|EYU31790.1| hypothetical protein MIMGU_mgv1a011004mg [Erythra... 58 4e-06 gb|EAZ12513.1| hypothetical protein OsJ_02409 [Oryza sativa Japo... 58 4e-06 ref|XP_006644321.1| PREDICTED: coiled-coil domain-containing pro... 58 4e-06 >ref|XP_008466970.1| PREDICTED: coiled-coil domain-containing protein 94 homolog, partial [Cucumis melo] Length = 116 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/47 (61%), Positives = 31/47 (65%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFD------LELSFFCIYFR 125 VRMMLPMSIRCNTC YIYKGTKFNS D L + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVIGETYLGIQIFRFYFK 79 >gb|ACJ83312.1| unknown [Medicago truncatula] Length = 122 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/47 (61%), Positives = 31/47 (65%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFD------LELSFFCIYFR 125 VRMMLPMSIRCNTC YIYKGTKFNS D L + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVIGETYLGIQIFRFYFK 79 >ref|XP_008803163.1| PREDICTED: coiled-coil domain-containing protein 94-like isoform X3 [Phoenix dactylifera] Length = 247 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/47 (63%), Positives = 32/47 (68%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFD------LELSFFCIYFR 125 VRMMLPMSIRCNTC TYIYKGTKFNS D L + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGTYIYKGTKFNSRKEDVIGDTYLGIQIFRFYFK 79 >ref|XP_008803162.1| PREDICTED: coiled-coil domain-containing protein 94-like isoform X2 [Phoenix dactylifera] Length = 257 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/47 (63%), Positives = 32/47 (68%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFD------LELSFFCIYFR 125 VRMMLPMSIRCNTC TYIYKGTKFNS D L + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGTYIYKGTKFNSRKEDVIGDTYLGIQIFRFYFK 79 >ref|XP_001781100.1| predicted protein [Physcomitrella patens] Length = 263 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFDLE------LSFFCIYFR 125 VRMMLPMSIRCNTC YIYKGTKFNS D+E + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVEGETYLGIQIFRFYFK 79 >ref|XP_009392910.1| PREDICTED: pre-mRNA-splicing factor cwf16 [Musa acuminata subsp. malaccensis] Length = 339 Score = 58.5 bits (140), Expect = 3e-06 Identities = 30/47 (63%), Positives = 32/47 (68%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFD------LELSFFCIYFR 125 VRMMLPMSIRCNTC TYIYKGTKFNS D L + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGTYIYKGTKFNSRKEDVVGETYLGIQIFRFYFK 79 >ref|XP_008803164.1| PREDICTED: coiled-coil domain-containing protein 94-like [Phoenix dactylifera] Length = 342 Score = 58.5 bits (140), Expect = 3e-06 Identities = 30/47 (63%), Positives = 32/47 (68%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFD------LELSFFCIYFR 125 VRMMLPMSIRCNTC TYIYKGTKFNS D L + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGTYIYKGTKFNSRKEDVIGDTYLGIQIFRFYFK 79 >ref|XP_008803161.1| PREDICTED: coiled-coil domain-containing protein 94-like isoform X1 [Phoenix dactylifera] Length = 342 Score = 58.5 bits (140), Expect = 3e-06 Identities = 30/47 (63%), Positives = 32/47 (68%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFD------LELSFFCIYFR 125 VRMMLPMSIRCNTC TYIYKGTKFNS D L + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGTYIYKGTKFNSRKEDVIGDTYLGIQIFRFYFK 79 >ref|XP_010942888.1| PREDICTED: coiled-coil domain-containing protein 94 [Elaeis guineensis] Length = 343 Score = 58.5 bits (140), Expect = 3e-06 Identities = 30/47 (63%), Positives = 32/47 (68%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFD------LELSFFCIYFR 125 VRMMLPMSIRCNTC TYIYKGTKFNS D L + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGTYIYKGTKFNSRKEDVVGETYLGIQIFRFYFK 79 >ref|XP_020102400.1| coiled-coil domain-containing protein 94 [Ananas comosus] Length = 344 Score = 58.5 bits (140), Expect = 3e-06 Identities = 30/47 (63%), Positives = 32/47 (68%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFD------LELSFFCIYFR 125 VRMMLPMSIRCNTC TYIYKGTKFNS D L + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGTYIYKGTKFNSRKEDVVGETYLGIQLFRFYFK 79 >gb|OAY65389.1| Coiled-coil domain-containing protein [Ananas comosus] Length = 344 Score = 58.5 bits (140), Expect = 3e-06 Identities = 30/47 (63%), Positives = 32/47 (68%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFD------LELSFFCIYFR 125 VRMMLPMSIRCNTC TYIYKGTKFNS D L + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGTYIYKGTKFNSRKEDVVGETYLGIQLFRFYFK 79 >gb|PKI47645.1| hypothetical protein CRG98_031931 [Punica granatum] Length = 289 Score = 58.2 bits (139), Expect = 3e-06 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFDLE------LSFFCIYFR 125 VRMMLPMSIRCNTC YIYKGTKFNS D+E + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVEGEKYLGIQIFRFYFK 79 >emb|CBI14833.3| unnamed protein product, partial [Vitis vinifera] Length = 183 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/47 (61%), Positives = 31/47 (65%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFD------LELSFFCIYFR 125 VRMMLPMSIRCNTC YIYKGTKFNS D L + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVIGETYLGIQIFRFYFK 79 >gb|OWM81028.1| hypothetical protein CDL15_Pgr007059 [Punica granatum] Length = 341 Score = 58.2 bits (139), Expect = 3e-06 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFDLE------LSFFCIYFR 125 VRMMLPMSIRCNTC YIYKGTKFNS D+E + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVEGEKYLGIQIFRFYFK 79 >ref|XP_019074265.1| PREDICTED: coiled-coil domain-containing protein 94 homolog isoform X2 [Vitis vinifera] Length = 184 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/47 (61%), Positives = 31/47 (65%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFD------LELSFFCIYFR 125 VRMMLPMSIRCNTC YIYKGTKFNS D L + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVIGETYLGIQIFRFYFK 79 >ref|XP_003635597.1| PREDICTED: coiled-coil domain-containing protein 94 homolog isoform X1 [Vitis vinifera] Length = 184 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/47 (61%), Positives = 31/47 (65%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFD------LELSFFCIYFR 125 VRMMLPMSIRCNTC YIYKGTKFNS D L + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVIGETYLGIQIFRFYFK 79 >gb|PNR29355.1| hypothetical protein PHYPA_028048 [Physcomitrella patens] Length = 352 Score = 58.2 bits (139), Expect = 4e-06 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFDLE------LSFFCIYFR 125 VRMMLPMSIRCNTC YIYKGTKFNS D+E + F YF+ Sbjct: 33 VRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVEGETYLGIQIFRFYFK 79 >gb|EYU31790.1| hypothetical protein MIMGU_mgv1a011004mg [Erythranthe guttata] Length = 295 Score = 57.8 bits (138), Expect = 4e-06 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 6/51 (11%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFD------LELSFFCIYFRRFCP 137 VRMMLPMSIRC TC YIYKGTKFNS D L + F YF+ F P Sbjct: 33 VRMMLPMSIRCGTCGNYIYKGTKFNSRKEDAVGEKYLGIQIFRFYFKNFEP 83 >gb|EAZ12513.1| hypothetical protein OsJ_02409 [Oryza sativa Japonica Group] Length = 309 Score = 57.8 bits (138), Expect = 4e-06 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFDLE------LSFFCIYFR 125 VRMMLPMSIRC TC TYIYKGTKFNS D+E + F YF+ Sbjct: 34 VRMMLPMSIRCGTCGTYIYKGTKFNSRKEDVEGEKYLGIQIFRFYFK 80 >ref|XP_006644321.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Oryza brachyantha] Length = 327 Score = 57.8 bits (138), Expect = 4e-06 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 6/47 (12%) Frame = +3 Query: 3 VRMMLPMSIRCNTCDTYIYKGTKFNSSCFDLE------LSFFCIYFR 125 VRMMLPMSIRC TC TYIYKGTKFNS D+E + F YF+ Sbjct: 33 VRMMLPMSIRCGTCGTYIYKGTKFNSRKEDVEGEKYLGIQIFRFYFK 79