BLASTX nr result
ID: Ophiopogon23_contig00015797
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00015797 (471 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254774.1| protease Do-like 2, chloroplastic [Asparagus... 65 4e-09 ref|XP_020679861.1| protease Do-like 2, chloroplastic isoform X2... 56 5e-06 ref|XP_020679859.1| protease Do-like 2, chloroplastic isoform X1... 56 5e-06 >ref|XP_020254774.1| protease Do-like 2, chloroplastic [Asparagus officinalis] gb|ONK78599.1| uncharacterized protein A4U43_C02F20500 [Asparagus officinalis] Length = 603 Score = 64.7 bits (156), Expect = 4e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 471 YVDSEDNQVSNTDEIGDSPVSNLEIGFDGLLWA 373 YVDSEDNQV N +EIGDSPV+NLEIGFDGLLWA Sbjct: 571 YVDSEDNQVMNKEEIGDSPVTNLEIGFDGLLWA 603 >ref|XP_020679861.1| protease Do-like 2, chloroplastic isoform X2 [Dendrobium catenatum] Length = 597 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 471 YVDSEDNQVSNTDEIGDSPVSNLEIGFDGLLWA 373 Y+D EDNQVS +EIGDSPVSNLE+GF+GLLWA Sbjct: 566 YIDIEDNQVS-IEEIGDSPVSNLELGFEGLLWA 597 >ref|XP_020679859.1| protease Do-like 2, chloroplastic isoform X1 [Dendrobium catenatum] ref|XP_020679860.1| protease Do-like 2, chloroplastic isoform X1 [Dendrobium catenatum] gb|PKU66080.1| Protease Do-like 2, chloroplastic [Dendrobium catenatum] Length = 615 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 471 YVDSEDNQVSNTDEIGDSPVSNLEIGFDGLLWA 373 Y+D EDNQVS +EIGDSPVSNLE+GF+GLLWA Sbjct: 584 YIDIEDNQVS-IEEIGDSPVSNLELGFEGLLWA 615