BLASTX nr result
ID: Ophiopogon23_contig00015755
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00015755 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244965.1| LOW QUALITY PROTEIN: receptor-like protein k... 73 3e-12 gb|ONK80132.1| uncharacterized protein A4U43_C01F14230 [Asparagu... 73 3e-12 ref|XP_019704991.1| PREDICTED: LOW QUALITY PROTEIN: receptor-lik... 62 3e-08 ref|XP_010919346.1| PREDICTED: receptor-like protein kinase HSL1... 60 9e-08 ref|XP_008783130.1| PREDICTED: receptor-like protein kinase HSL1... 56 2e-06 ref|XP_010260335.1| PREDICTED: receptor-like protein kinase HSL1... 56 3e-06 gb|ABN08715.1| Protein kinase [Medicago truncatula] 55 5e-06 ref|XP_003593649.2| LRR receptor-like kinase family protein [Med... 55 5e-06 gb|PON97836.1| Serine/threonine protein kinase [Trema orientalis] 55 7e-06 ref|XP_008789980.1| PREDICTED: receptor-like protein kinase HSL1... 55 7e-06 ref|XP_010245580.1| PREDICTED: receptor-like protein kinase HSL1... 54 9e-06 ref|XP_018806128.1| PREDICTED: receptor-like protein kinase HSL1... 54 9e-06 ref|XP_018810374.1| PREDICTED: receptor-like protein kinase HSL1... 54 9e-06 >ref|XP_020244965.1| LOW QUALITY PROTEIN: receptor-like protein kinase HSL1 [Asparagus officinalis] Length = 982 Score = 72.8 bits (177), Expect = 3e-12 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +1 Query: 1 NLPMNRPSMRRVVKMLLEVSPDESKPKPNKEKEQDKDAKLSPYYY 135 NLPMNRPSMRRVVKMLLEVSPDESK KP +++EQD LSPYYY Sbjct: 929 NLPMNRPSMRRVVKMLLEVSPDESKAKPKQQEEQDAKL-LSPYYY 972 >gb|ONK80132.1| uncharacterized protein A4U43_C01F14230 [Asparagus officinalis] Length = 1097 Score = 72.8 bits (177), Expect = 3e-12 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +1 Query: 1 NLPMNRPSMRRVVKMLLEVSPDESKPKPNKEKEQDKDAKLSPYYY 135 NLPMNRPSMRRVVKMLLEVSPDESK KP +++EQD LSPYYY Sbjct: 908 NLPMNRPSMRRVVKMLLEVSPDESKAKPKQQEEQDAKL-LSPYYY 951 >ref|XP_019704991.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase HSL1, partial [Elaeis guineensis] Length = 997 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +1 Query: 1 NLPMNRPSMRRVVKMLLEVSPDESKPKPNKEKEQDKDAKLSPYYY 135 +LP+NRPSMRRVVKMLLEVSPD++KP + +D KLSPYYY Sbjct: 950 SLPINRPSMRRVVKMLLEVSPDKAKP-------EKRDGKLSPYYY 987 >ref|XP_010919346.1| PREDICTED: receptor-like protein kinase HSL1 [Elaeis guineensis] Length = 999 Score = 60.1 bits (144), Expect = 9e-08 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = +1 Query: 4 LPMNRPSMRRVVKMLLEVSPDES-KPKPNKEKEQDKDAKLSPYYY 135 LP+NRPSMR+VVKMLLEV P+E KPKP K K KD +LSPYYY Sbjct: 946 LPINRPSMRQVVKMLLEVRPEEKPKPKP-KPKPVMKDGQLSPYYY 989 >ref|XP_008783130.1| PREDICTED: receptor-like protein kinase HSL1 [Phoenix dactylifera] Length = 1000 Score = 56.2 bits (134), Expect = 2e-06 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +1 Query: 1 NLPMNRPSMRRVVKMLLEVSPDESKPKPNKEKEQDKDAKLSPYYY 135 +LP+NRPSMRRVVKMLLEVS + KPNK ++ +D KLSPYYY Sbjct: 952 SLPINRPSMRRVVKMLLEVSTN----KPNKPEK--RDGKLSPYYY 990 >ref|XP_010260335.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera] Length = 991 Score = 55.8 bits (133), Expect = 3e-06 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = +1 Query: 1 NLPMNRPSMRRVVKMLLEVSPDESKPKPNKEKEQDKDAKLSPYYY 135 +LP+NRPSMRRVVKML EVS E+KPK K KD KLSPYYY Sbjct: 943 HLPINRPSMRRVVKMLQEVSA-ENKPKTGK-----KDGKLSPYYY 981 >gb|ABN08715.1| Protein kinase [Medicago truncatula] Length = 969 Score = 55.1 bits (131), Expect = 5e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 4 LPMNRPSMRRVVKMLLEVSPDESKPKPNKEKEQDKDAKLSPYYY 135 LP+NRP+MRRVVKMLLEV P+ ++ K KD KLSPYYY Sbjct: 922 LPINRPAMRRVVKMLLEVGPE------SQTKSSQKDGKLSPYYY 959 >ref|XP_003593649.2| LRR receptor-like kinase family protein [Medicago truncatula] gb|AES63900.2| LRR receptor-like kinase family protein [Medicago truncatula] Length = 993 Score = 55.1 bits (131), Expect = 5e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 4 LPMNRPSMRRVVKMLLEVSPDESKPKPNKEKEQDKDAKLSPYYY 135 LP+NRP+MRRVVKMLLEV P+ ++ K KD KLSPYYY Sbjct: 946 LPINRPAMRRVVKMLLEVGPE------SQTKSSQKDGKLSPYYY 983 >gb|PON97836.1| Serine/threonine protein kinase [Trema orientalis] Length = 995 Score = 54.7 bits (130), Expect = 7e-06 Identities = 29/44 (65%), Positives = 30/44 (68%) Frame = +1 Query: 4 LPMNRPSMRRVVKMLLEVSPDESKPKPNKEKEQDKDAKLSPYYY 135 LP+NRPSMRRVVKML E S D NK K KD KLSPYYY Sbjct: 947 LPINRPSMRRVVKMLQEASSD------NKSKSGRKDGKLSPYYY 984 >ref|XP_008789980.1| PREDICTED: receptor-like protein kinase HSL1 [Phoenix dactylifera] Length = 997 Score = 54.7 bits (130), Expect = 7e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = +1 Query: 4 LPMNRPSMRRVVKMLLEVSPDESKPKPNKEKEQDKDAKLSPYYY 135 LP+NRPSMRRVVKMLLEV P+E + K + KD KLSP YY Sbjct: 947 LPINRPSMRRVVKMLLEVRPEEK----TRHKPEMKDGKLSPCYY 986 >ref|XP_010245580.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera] Length = 992 Score = 54.3 bits (129), Expect = 9e-06 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = +1 Query: 1 NLPMNRPSMRRVVKMLLEVSPDESKPKPNKEKEQDKDAKLSPYYY 135 +LP+NRPSMRRVVKML EV E+KPK K KD KLSPYYY Sbjct: 944 SLPINRPSMRRVVKMLQEVGA-ENKPKAGK-----KDGKLSPYYY 982 >ref|XP_018806128.1| PREDICTED: receptor-like protein kinase HSL1 [Juglans regia] Length = 993 Score = 54.3 bits (129), Expect = 9e-06 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = +1 Query: 4 LPMNRPSMRRVVKMLLEVSPDESKPKPNKEKEQDKDAKLSPYYY 135 LP+NRPSMRRVVKML EV P+ N+ K KD KLSPYYY Sbjct: 946 LPINRPSMRRVVKMLQEVCPE------NQSKMPKKDGKLSPYYY 983 >ref|XP_018810374.1| PREDICTED: receptor-like protein kinase HSL1 [Juglans regia] Length = 996 Score = 54.3 bits (129), Expect = 9e-06 Identities = 29/44 (65%), Positives = 30/44 (68%) Frame = +1 Query: 4 LPMNRPSMRRVVKMLLEVSPDESKPKPNKEKEQDKDAKLSPYYY 135 LP+NRPSMRRVVKML EVSP N K KD KLSPYYY Sbjct: 949 LPINRPSMRRVVKMLREVSP------VNHSKTAKKDGKLSPYYY 986