BLASTX nr result
ID: Ophiopogon23_contig00015678
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00015678 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHN49725.1| calcium-dependent protein kinase 1 [Hippeastrum h... 55 4e-06 >gb|AHN49725.1| calcium-dependent protein kinase 1 [Hippeastrum hybrid cultivar] Length = 531 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 2/31 (6%) Frame = +2 Query: 266 MGLCFSKGKDTRPEPNVYSSYQRPP--PSEP 352 MGLCFSKGKDT+P+PN YSSYQRPP P++P Sbjct: 1 MGLCFSKGKDTKPKPNGYSSYQRPPAEPTKP 31