BLASTX nr result
ID: Ophiopogon23_contig00015050
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00015050 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246032.1| probable NAD kinase 2, chloroplastic [Aspara... 55 6e-06 >ref|XP_020246032.1| probable NAD kinase 2, chloroplastic [Asparagus officinalis] ref|XP_020246033.1| probable NAD kinase 2, chloroplastic [Asparagus officinalis] ref|XP_020246034.1| probable NAD kinase 2, chloroplastic [Asparagus officinalis] gb|ONK57610.1| uncharacterized protein A4U43_C09F2250 [Asparagus officinalis] Length = 992 Score = 55.1 bits (131), Expect = 6e-06 Identities = 37/61 (60%), Positives = 37/61 (60%), Gaps = 2/61 (3%) Frame = +1 Query: 244 MLGACGAHAPL-KISIQPVS-GDRLDCLLSNSKRKWWWSNRPAPARSVAVGARLSSFFSS 417 ML CGAH PL KIS S GDR L KWW NR P RSVAVGARLSSF SS Sbjct: 1 MLWTCGAHGPLVKISSSAFSPGDRRRLL------KWW--NRGVPMRSVAVGARLSSFLSS 52 Query: 418 P 420 P Sbjct: 53 P 53