BLASTX nr result
ID: Ophiopogon23_contig00014520
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00014520 (521 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OXU26519.1| hypothetical protein TSAR_011779 [Trichomalopsis ... 61 1e-07 ref|XP_016843758.1| PREDICTED: agrin-like isoform X2 [Nasonia vi... 61 1e-07 ref|XP_016843757.1| PREDICTED: agrin-like isoform X1 [Nasonia vi... 61 1e-07 >gb|OXU26519.1| hypothetical protein TSAR_011779 [Trichomalopsis sarcophagae] Length = 1497 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/53 (50%), Positives = 30/53 (56%) Frame = +3 Query: 147 EPSCICRVQKSYFPTCGSDDKTYVNPSVLECEKKCTKSALKKKYSGPCGKKWE 305 + C C K Y P CGSD TY NPS L C +KC KS LK Y G C K+ E Sbjct: 457 DDKCKCIADKDYNPVCGSDGNTYANPSTLFCAEKCLKSDLKLSYCGKCNKQKE 509 >ref|XP_016843758.1| PREDICTED: agrin-like isoform X2 [Nasonia vitripennis] Length = 961 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/53 (50%), Positives = 30/53 (56%) Frame = +3 Query: 147 EPSCICRVQKSYFPTCGSDDKTYVNPSVLECEKKCTKSALKKKYSGPCGKKWE 305 + C C K Y P CGSD TY NPS L C +KC KS LK Y G C K+ E Sbjct: 293 DDKCKCIADKDYNPVCGSDGNTYANPSTLFCAEKCLKSNLKLSYCGKCDKQKE 345 >ref|XP_016843757.1| PREDICTED: agrin-like isoform X1 [Nasonia vitripennis] Length = 992 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/53 (50%), Positives = 30/53 (56%) Frame = +3 Query: 147 EPSCICRVQKSYFPTCGSDDKTYVNPSVLECEKKCTKSALKKKYSGPCGKKWE 305 + C C K Y P CGSD TY NPS L C +KC KS LK Y G C K+ E Sbjct: 324 DDKCKCIADKDYNPVCGSDGNTYANPSTLFCAEKCLKSNLKLSYCGKCDKQKE 376