BLASTX nr result
ID: Ophiopogon23_contig00014029
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00014029 (376 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK70077.1| uncharacterized protein A4U43_C05F30000 [Asparagu... 82 1e-15 ref|XP_020265298.1| uncharacterized protein LOC109840888 isoform... 77 8e-15 ref|XP_020265295.1| uncharacterized protein LOC109840888 isoform... 77 2e-14 >gb|ONK70077.1| uncharacterized protein A4U43_C05F30000 [Asparagus officinalis] Length = 370 Score = 81.6 bits (200), Expect = 1e-15 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 131 PLKMFEVPRDNTASPKQHESGPNYFAYYKHLVLDLLSENGTCF 3 PL M E+PRDNTASPKQ+E PNYFAYYKH++LDLLSENGTCF Sbjct: 90 PLNMSEIPRDNTASPKQNEFSPNYFAYYKHVILDLLSENGTCF 132 >ref|XP_020265298.1| uncharacterized protein LOC109840888 isoform X3 [Asparagus officinalis] Length = 223 Score = 77.4 bits (189), Expect = 8e-15 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -3 Query: 122 MFEVPRDNTASPKQHESGPNYFAYYKHLVLDLLSENGTCF 3 M E+PRDNTASPKQ+E PNYFAYYKH++LDLLSENGTCF Sbjct: 1 MSEIPRDNTASPKQNEFSPNYFAYYKHVILDLLSENGTCF 40 >ref|XP_020265295.1| uncharacterized protein LOC109840888 isoform X1 [Asparagus officinalis] ref|XP_020265296.1| uncharacterized protein LOC109840888 isoform X1 [Asparagus officinalis] Length = 278 Score = 77.4 bits (189), Expect = 2e-14 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -3 Query: 122 MFEVPRDNTASPKQHESGPNYFAYYKHLVLDLLSENGTCF 3 M E+PRDNTASPKQ+E PNYFAYYKH++LDLLSENGTCF Sbjct: 1 MSEIPRDNTASPKQNEFSPNYFAYYKHVILDLLSENGTCF 40