BLASTX nr result
ID: Ophiopogon23_contig00012697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00012697 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020260146.1| phytoene synthase 2, chloroplastic-like [Asp... 57 1e-06 >ref|XP_020260146.1| phytoene synthase 2, chloroplastic-like [Asparagus officinalis] gb|ONK71063.1| uncharacterized protein A4U43_C04F4320 [Asparagus officinalis] Length = 414 Score = 57.0 bits (136), Expect = 1e-06 Identities = 49/131 (37%), Positives = 60/131 (45%), Gaps = 41/131 (31%) Frame = +3 Query: 150 KMHCVASAVEFSAGLGSSEAVVRGGRLELIRRSQRKKPVWSASSVYGHLKPAG------- 308 +M V S VEF A LGSSE V+ GRL L+RR+QRKKP+ A S+Y K A Sbjct: 4 QMQWVVSPVEFFAKLGSSE--VKEGRLGLLRRTQRKKPILRAFSIYTDSKTAAQVSTASG 61 Query: 309 -----------------NSPAISSEQKAKKQKLK---------SSTSSFDMKPE------ 392 AISSE+K LK SS + D+ PE Sbjct: 62 SGADGFPLLATLVANPDGEIAISSEEKVYDVVLKQAALVREQLSSNVATDVNPELAVPGS 121 Query: 393 --LLKEAYDQC 419 L+KEAYD+C Sbjct: 122 MDLMKEAYDRC 132