BLASTX nr result
ID: Ophiopogon23_contig00012319
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00012319 (371 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BBC66038.1| hypothetical protein MMRN_29340 [Mycobacterium m... 56 2e-06 >dbj|BBC66038.1| hypothetical protein MMRN_29340 [Mycobacterium marinum] Length = 522 Score = 55.8 bits (133), Expect = 2e-06 Identities = 37/108 (34%), Positives = 48/108 (44%), Gaps = 1/108 (0%) Frame = +2 Query: 8 HTSSRHNTNITPYGHNNPHTAQNQHLT-SIHHTTPQHMTYYVKPTASRTQTHKRQLHHQP 184 H ++ HN NIT Y H+ PHT L + HT P Y T + H Q H Sbjct: 356 HLTTNHNNNITLYQHHQPHTYTGPTLLIAAEHTPPPTTPYESTHTKAAYLLHAWQPHLTG 415 Query: 185 HSLTIPRSQTHLQLRHPNTTPKTASTATLHPSHQAHQSVTKSHRINKL 328 + T + TH QL HPN TP T +T+ S Q + + H N L Sbjct: 416 PTTTHSTNSTHHQLLHPNHTPPTPTTS--KTSSNDTQVIQRRHLRNGL 461