BLASTX nr result
ID: Ophiopogon23_contig00012204
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00012204 (376 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244605.1| vacuolar-sorting receptor 3-like [Asparagus ... 74 1e-12 ref|XP_020689742.1| vacuolar-sorting receptor 3-like [Dendrobium... 71 1e-11 ref|XP_020575433.1| vacuolar-sorting receptor 3-like [Phalaenops... 71 1e-11 gb|PKU59271.1| Vacuolar-sorting receptor 1 [Dendrobium catenatum] 71 1e-11 ref|XP_008779827.1| PREDICTED: vacuolar-sorting receptor 4-like,... 67 2e-11 gb|PKA49793.1| Vacuolar-sorting receptor 3 [Apostasia shenzhenica] 69 4e-11 ref|XP_010938945.1| PREDICTED: vacuolar-sorting receptor 3-like ... 67 2e-10 ref|XP_009404782.1| PREDICTED: vacuolar-sorting receptor 4-like ... 67 3e-10 ref|XP_011092498.1| vacuolar-sorting receptor 3 [Sesamum indicum] 66 4e-10 ref|XP_008805693.1| PREDICTED: vacuolar-sorting receptor 3-like ... 66 6e-10 gb|AEZ00905.1| putative BP-80 vacuolar sorting receptor protein,... 65 6e-10 gb|EAY78120.1| hypothetical protein OsI_33166 [Oryza sativa Indi... 64 1e-09 ref|XP_010942821.1| PREDICTED: vacuolar-sorting receptor 1 [Elae... 65 1e-09 ref|XP_004983263.1| vacuolar-sorting receptor 3 [Setaria italica... 65 1e-09 gb|PAN48045.1| hypothetical protein PAHAL_I03630 [Panicum hallii] 65 1e-09 gb|KZV50555.1| vacuolar-sorting receptor 3 [Dorcoceras hygrometr... 64 3e-09 gb|ACG44286.1| vacuolar sorting receptor 3 precursor [Zea mays] 64 4e-09 gb|ACN30885.1| unknown [Zea mays] 64 4e-09 ref|XP_015614532.1| PREDICTED: vacuolar-sorting receptor 3 [Oryz... 64 4e-09 ref|NP_001130741.1| uncharacterized protein LOC100191845 precurs... 64 4e-09 >ref|XP_020244605.1| vacuolar-sorting receptor 3-like [Asparagus officinalis] gb|ONK59951.1| uncharacterized protein A4U43_C08F12630 [Asparagus officinalis] Length = 625 Score = 73.6 bits (179), Expect = 1e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEENI 108 RLRSYMDSEIRAIMAQYMPLDSQNEVPSH+H+EENI Sbjct: 587 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHSHDEENI 622 >ref|XP_020689742.1| vacuolar-sorting receptor 3-like [Dendrobium catenatum] Length = 633 Score = 70.9 bits (172), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEENI 108 RLRSYMDSEIRAIMAQYMPLDSQNEVPSH+HEE +I Sbjct: 598 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHSHEENHI 633 >ref|XP_020575433.1| vacuolar-sorting receptor 3-like [Phalaenopsis equestris] Length = 633 Score = 70.9 bits (172), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEENI 108 RLRSYMDSEIRAIMAQYMPLDSQNEVPSH+HEE +I Sbjct: 598 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHSHEENHI 633 >gb|PKU59271.1| Vacuolar-sorting receptor 1 [Dendrobium catenatum] Length = 707 Score = 70.9 bits (172), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEENI 108 RLRSYMDSEIRAIMAQYMPLDSQNEVPSH+HEE +I Sbjct: 672 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHSHEENHI 707 >ref|XP_008779827.1| PREDICTED: vacuolar-sorting receptor 4-like, partial [Phoenix dactylifera] Length = 162 Score = 67.0 bits (162), Expect = 2e-11 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEENI 108 RLRSYMDSEIRAIMAQYMPLDSQ EVP+H HEE+ + Sbjct: 127 RLRSYMDSEIRAIMAQYMPLDSQGEVPNHTHEEDRV 162 >gb|PKA49793.1| Vacuolar-sorting receptor 3 [Apostasia shenzhenica] Length = 685 Score = 69.3 bits (168), Expect = 4e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEEN 105 RLRSYMDSEIRAIMAQYMPLDSQNEVPSH+HEE + Sbjct: 650 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHSHEESH 684 >ref|XP_010938945.1| PREDICTED: vacuolar-sorting receptor 3-like [Elaeis guineensis] Length = 633 Score = 67.0 bits (162), Expect = 2e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEEN 105 RLRSYMDSEIRAIMAQYMPLDSQ EVP+HAHEE + Sbjct: 598 RLRSYMDSEIRAIMAQYMPLDSQGEVPNHAHEENH 632 >ref|XP_009404782.1| PREDICTED: vacuolar-sorting receptor 4-like [Musa acuminata subsp. malaccensis] Length = 633 Score = 66.6 bits (161), Expect = 3e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEEN 105 RLRSYMDSEIRAIMAQYMPLDSQ EVP+H+HEE++ Sbjct: 598 RLRSYMDSEIRAIMAQYMPLDSQGEVPNHSHEEDH 632 >ref|XP_011092498.1| vacuolar-sorting receptor 3 [Sesamum indicum] Length = 630 Score = 66.2 bits (160), Expect = 4e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEE 99 RLRSYMDSEIRAIMAQYMPLDSQNEVP+H HE+ Sbjct: 596 RLRSYMDSEIRAIMAQYMPLDSQNEVPNHVHED 628 >ref|XP_008805693.1| PREDICTED: vacuolar-sorting receptor 3-like [Phoenix dactylifera] Length = 633 Score = 65.9 bits (159), Expect = 6e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEEN 105 RLRSYMDSEIRAIMAQYMPLDSQ EVP+HAHE+ + Sbjct: 598 RLRSYMDSEIRAIMAQYMPLDSQGEVPNHAHEQNH 632 >gb|AEZ00905.1| putative BP-80 vacuolar sorting receptor protein, partial [Elaeis guineensis] Length = 243 Score = 64.7 bits (156), Expect = 6e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEE 102 RLRSYMDSEIRAIMAQYMPLDSQ EVP+HA+EE+ Sbjct: 208 RLRSYMDSEIRAIMAQYMPLDSQGEVPNHANEED 241 >gb|EAY78120.1| hypothetical protein OsI_33166 [Oryza sativa Indica Group] Length = 215 Score = 63.5 bits (153), Expect = 1e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEEN 105 RLRSYMDSEIRAIMAQYMPLDSQ EVP+H ++EE+ Sbjct: 180 RLRSYMDSEIRAIMAQYMPLDSQGEVPNHTNDEEH 214 >ref|XP_010942821.1| PREDICTED: vacuolar-sorting receptor 1 [Elaeis guineensis] Length = 631 Score = 64.7 bits (156), Expect = 1e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEE 102 RLRSYMDSEIRAIMAQYMPLDSQ EVP+HA+EE+ Sbjct: 596 RLRSYMDSEIRAIMAQYMPLDSQGEVPNHANEED 629 >ref|XP_004983263.1| vacuolar-sorting receptor 3 [Setaria italica] gb|KQK89329.1| hypothetical protein SETIT_034675mg [Setaria italica] Length = 631 Score = 64.7 bits (156), Expect = 1e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEE 102 RLRSYMDSEIRAIMAQYMPLD+Q EVP+H HEE+ Sbjct: 596 RLRSYMDSEIRAIMAQYMPLDNQGEVPNHTHEED 629 >gb|PAN48045.1| hypothetical protein PAHAL_I03630 [Panicum hallii] Length = 632 Score = 64.7 bits (156), Expect = 1e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEE 102 RLRSYMDSEIRAIMAQYMPLD+Q EVP+H HEE+ Sbjct: 597 RLRSYMDSEIRAIMAQYMPLDNQGEVPNHTHEED 630 >gb|KZV50555.1| vacuolar-sorting receptor 3 [Dorcoceras hygrometricum] Length = 614 Score = 63.9 bits (154), Expect = 3e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEE 99 RLRSYMDSEIRAIMAQYMPLDSQ+EVPSH H++ Sbjct: 580 RLRSYMDSEIRAIMAQYMPLDSQHEVPSHRHDD 612 >gb|ACG44286.1| vacuolar sorting receptor 3 precursor [Zea mays] Length = 575 Score = 63.5 bits (153), Expect = 4e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEE 102 RLRSYMDSEIRAIMAQYMPLD+Q EVP+H H+E+ Sbjct: 540 RLRSYMDSEIRAIMAQYMPLDNQGEVPNHTHDED 573 >gb|ACN30885.1| unknown [Zea mays] Length = 625 Score = 63.5 bits (153), Expect = 4e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEE 102 RLRSYMDSEIRAIMAQYMPLD+Q EVP+H H+E+ Sbjct: 590 RLRSYMDSEIRAIMAQYMPLDNQGEVPNHTHDED 623 >ref|XP_015614532.1| PREDICTED: vacuolar-sorting receptor 3 [Oryza sativa Japonica Group] gb|AAK92655.1|AC079634_16 Putative vacuolar sorting receptor protein homolog [Oryza sativa Japonica Group] gb|ABB47273.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza sativa Japonica Group] dbj|BAF26314.1| Os10g0346600 [Oryza sativa Japonica Group] gb|EAZ15760.1| hypothetical protein OsJ_31179 [Oryza sativa Japonica Group] dbj|BAT10441.1| Os10g0346600 [Oryza sativa Japonica Group] Length = 631 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEEN 105 RLRSYMDSEIRAIMAQYMPLDSQ EVP+H ++EE+ Sbjct: 596 RLRSYMDSEIRAIMAQYMPLDSQGEVPNHTNDEEH 630 >ref|NP_001130741.1| uncharacterized protein LOC100191845 precursor [Zea mays] gb|ACF79081.1| unknown [Zea mays] Length = 632 Score = 63.5 bits (153), Expect = 4e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 1 RLRSYMDSEIRAIMAQYMPLDSQNEVPSHAHEEE 102 RLRSYMDSEIRAIMAQYMPLD+Q EVP+H H+E+ Sbjct: 597 RLRSYMDSEIRAIMAQYMPLDNQGEVPNHTHDED 630