BLASTX nr result
ID: Ophiopogon23_contig00012153
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00012153 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011459750.1| PREDICTED: sperm protein associated with the... 56 2e-06 >ref|XP_011459750.1| PREDICTED: sperm protein associated with the nucleus on the X chromosome N2-like [Fragaria vesca subsp. vesca] Length = 271 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -2 Query: 98 GGVKVELKPFDGRSNFTLWQRKMKNILIQQD 6 G VKV +KPFDG+ +FTLWQRKMKN+LIQQ+ Sbjct: 11 GDVKVSIKPFDGKDDFTLWQRKMKNVLIQQE 41