BLASTX nr result
ID: Ophiopogon23_contig00012099
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00012099 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246281.1| thioredoxin Y, chloroplastic-like [Asparagus... 62 1e-09 gb|OAY74043.1| Thioredoxin Y, chloroplastic, partial [Ananas com... 56 1e-07 gb|PKA46998.1| Thioredoxin Y, chloroplastic [Apostasia shenzhenica] 57 1e-07 ref|XP_009406121.1| PREDICTED: thioredoxin Y, chloroplastic [Mus... 57 2e-07 ref|XP_020080412.1| thioredoxin Y, chloroplastic-like [Ananas co... 56 4e-07 ref|XP_004496464.1| PREDICTED: thioredoxin Y1, chloroplastic-lik... 55 7e-07 ref|XP_023902067.1| uncharacterized protein LOC112013919 [Quercu... 55 9e-07 ref|XP_008381831.1| PREDICTED: thioredoxin Y1, chloroplastic-lik... 52 1e-06 ref|XP_018844203.1| PREDICTED: thioredoxin Y1, chloroplastic-lik... 53 1e-06 ref|XP_018844200.1| PREDICTED: thioredoxin Y1, chloroplastic-lik... 53 1e-06 gb|KFK42093.1| hypothetical protein AALP_AA2G209900 [Arabis alpina] 54 2e-06 ref|XP_018848154.1| PREDICTED: thioredoxin Y1, chloroplastic-lik... 54 2e-06 ref|XP_012446209.1| PREDICTED: thioredoxin Y1, chloroplastic [Go... 54 2e-06 ref|XP_006473069.1| PREDICTED: thioredoxin Y1, chloroplastic [Ci... 54 2e-06 ref|XP_006434475.1| thioredoxin Y1, chloroplastic [Citrus clemen... 54 2e-06 ref|XP_024167359.1| thioredoxin Y1, chloroplastic-like [Rosa chi... 54 2e-06 ref|XP_021897087.1| thioredoxin Y1, chloroplastic-like [Carica p... 54 2e-06 gb|KJB59446.1| hypothetical protein B456_009G254900 [Gossypium r... 54 2e-06 ref|XP_022974037.1| thioredoxin Y1, chloroplastic-like [Cucurbit... 54 2e-06 ref|XP_002266350.1| PREDICTED: uncharacterized protein LOC100245... 54 2e-06 >ref|XP_020246281.1| thioredoxin Y, chloroplastic-like [Asparagus officinalis] gb|ONK57567.1| uncharacterized protein A4U43_C09F1820 [Asparagus officinalis] Length = 138 Score = 61.6 bits (148), Expect = 1e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 IIFKDGKP +RFEGAFPADQLIQRIENALKV Sbjct: 106 IIFKDGKPCERFEGAFPADQLIQRIENALKV 136 >gb|OAY74043.1| Thioredoxin Y, chloroplastic, partial [Ananas comosus] Length = 110 Score = 55.8 bits (133), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 IIF+DGKP DRFEGA PA+QLIQRIE+ALKV Sbjct: 78 IIFRDGKPCDRFEGALPANQLIQRIESALKV 108 >gb|PKA46998.1| Thioredoxin Y, chloroplastic [Apostasia shenzhenica] Length = 168 Score = 57.0 bits (136), Expect = 1e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKVPK 99 IIF+DGKP DR EGA PA+QLI+RIENALKVP+ Sbjct: 136 IIFRDGKPCDRLEGAVPAEQLIKRIENALKVPQ 168 >ref|XP_009406121.1| PREDICTED: thioredoxin Y, chloroplastic [Musa acuminata subsp. malaccensis] ref|XP_009406122.1| PREDICTED: thioredoxin Y, chloroplastic [Musa acuminata subsp. malaccensis] ref|XP_009406123.1| PREDICTED: thioredoxin Y, chloroplastic [Musa acuminata subsp. malaccensis] ref|XP_009406124.1| PREDICTED: thioredoxin Y, chloroplastic [Musa acuminata subsp. malaccensis] Length = 170 Score = 56.6 bits (135), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 IIFKDGKPLDRFEGA PA QLIQRIE+A KV Sbjct: 138 IIFKDGKPLDRFEGAMPAHQLIQRIEDAFKV 168 >ref|XP_020080412.1| thioredoxin Y, chloroplastic-like [Ananas comosus] ref|XP_020107624.1| thioredoxin Y, chloroplastic [Ananas comosus] gb|OAY74048.1| Thioredoxin Y, chloroplastic [Ananas comosus] Length = 169 Score = 55.8 bits (133), Expect = 4e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 IIF+DGKP DRFEGA PA+QLIQRIE+ALKV Sbjct: 137 IIFRDGKPCDRFEGALPANQLIQRIESALKV 167 >ref|XP_004496464.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Cicer arietinum] Length = 165 Score = 55.1 bits (131), Expect = 7e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 IIFKDGKP DRFEGA PAD+LI+RIE +LKV Sbjct: 133 IIFKDGKPFDRFEGALPADKLIERIETSLKV 163 >ref|XP_023902067.1| uncharacterized protein LOC112013919 [Quercus suber] ref|XP_023902068.1| uncharacterized protein LOC112013919 [Quercus suber] gb|POE48528.1| thioredoxin y1, chloroplastic [Quercus suber] Length = 180 Score = 55.1 bits (131), Expect = 9e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 IIFKDG+P DRFEGA ADQLIQRIEN+LKV Sbjct: 148 IIFKDGEPYDRFEGALSADQLIQRIENSLKV 178 >ref|XP_008381831.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Malus domestica] Length = 74 Score = 52.4 bits (124), Expect = 1e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKVPK 99 IIFKDG+P DRFEGA ADQL++RIE LKV K Sbjct: 42 IIFKDGEPFDRFEGALTADQLVERIETTLKVRK 74 >ref|XP_018844203.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Juglans regia] Length = 112 Score = 53.1 bits (126), Expect = 1e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 I+F+DG+P DRFEGA ADQLIQRIEN+LKV Sbjct: 80 ILFRDGEPYDRFEGALTADQLIQRIENSLKV 110 >ref|XP_018844200.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Juglans regia] Length = 112 Score = 53.1 bits (126), Expect = 1e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 I+F+DG+P DRFEGA ADQLIQRIEN+LKV Sbjct: 80 ILFRDGEPYDRFEGALTADQLIQRIENSLKV 110 >gb|KFK42093.1| hypothetical protein AALP_AA2G209900 [Arabis alpina] Length = 173 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKVPK 99 I+FKDG+PLDRFEGA A+QLIQRIEN+L+V K Sbjct: 140 ILFKDGQPLDRFEGALAANQLIQRIENSLEVKK 172 >ref|XP_018848154.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Juglans regia] Length = 167 Score = 53.9 bits (128), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 I+FKDG+P DRFEGA ADQLIQRIEN+LKV Sbjct: 135 IMFKDGEPYDRFEGALTADQLIQRIENSLKV 165 >ref|XP_012446209.1| PREDICTED: thioredoxin Y1, chloroplastic [Gossypium raimondii] ref|XP_012446210.1| PREDICTED: thioredoxin Y1, chloroplastic [Gossypium raimondii] ref|XP_012446211.1| PREDICTED: thioredoxin Y1, chloroplastic [Gossypium raimondii] ref|XP_016698342.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Gossypium hirsutum] ref|XP_016698343.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Gossypium hirsutum] ref|XP_016698344.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Gossypium hirsutum] gb|KJB59440.1| hypothetical protein B456_009G254900 [Gossypium raimondii] gb|KJB59441.1| hypothetical protein B456_009G254900 [Gossypium raimondii] gb|KJB59444.1| hypothetical protein B456_009G254900 [Gossypium raimondii] gb|PPD67572.1| hypothetical protein GOBAR_DD35551 [Gossypium barbadense] Length = 167 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 IIFKDGKPLDRFEGA ADQLIQRIE +L V Sbjct: 135 IIFKDGKPLDRFEGALGADQLIQRIETSLSV 165 >ref|XP_006473069.1| PREDICTED: thioredoxin Y1, chloroplastic [Citrus sinensis] gb|KDO83753.1| hypothetical protein CISIN_1g030351mg [Citrus sinensis] Length = 169 Score = 53.9 bits (128), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 I+FKDGKP DRFEGAF DQLIQRIEN+L V Sbjct: 137 ILFKDGKPSDRFEGAFSKDQLIQRIENSLSV 167 >ref|XP_006434475.1| thioredoxin Y1, chloroplastic [Citrus clementina] gb|ESR47715.1| hypothetical protein CICLE_v10002691mg [Citrus clementina] Length = 169 Score = 53.9 bits (128), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 I+FKDGKP DRFEGAF DQLIQRIEN+L V Sbjct: 137 ILFKDGKPSDRFEGAFTKDQLIQRIENSLSV 167 >ref|XP_024167359.1| thioredoxin Y1, chloroplastic-like [Rosa chinensis] ref|XP_024167361.1| thioredoxin Y1, chloroplastic-like [Rosa chinensis] gb|PRQ24677.1| putative protein-disulfide reductase [Rosa chinensis] Length = 171 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 IIFKDGKP DRFEGA ADQLI+RIE ALKV Sbjct: 139 IIFKDGKPYDRFEGALNADQLIERIETALKV 169 >ref|XP_021897087.1| thioredoxin Y1, chloroplastic-like [Carica papaya] ref|XP_021897097.1| thioredoxin Y1, chloroplastic-like [Carica papaya] Length = 172 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 I+FKDGKP+DRFEGA A+QLI+RIEN+LKV Sbjct: 140 ILFKDGKPIDRFEGALTANQLIERIENSLKV 170 >gb|KJB59446.1| hypothetical protein B456_009G254900 [Gossypium raimondii] gb|KJB59447.1| hypothetical protein B456_009G254900 [Gossypium raimondii] Length = 173 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 IIFKDGKPLDRFEGA ADQLIQRIE +L V Sbjct: 141 IIFKDGKPLDRFEGALGADQLIQRIETSLSV 171 >ref|XP_022974037.1| thioredoxin Y1, chloroplastic-like [Cucurbita maxima] ref|XP_022974038.1| thioredoxin Y1, chloroplastic-like [Cucurbita maxima] Length = 174 Score = 53.9 bits (128), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 I+FKDGKPLDRFEGA A +LIQRIEN+LKV Sbjct: 142 ILFKDGKPLDRFEGALAAGELIQRIENSLKV 172 >ref|XP_002266350.1| PREDICTED: uncharacterized protein LOC100245159 [Vitis vinifera] emb|CBI18218.3| unnamed protein product, partial [Vitis vinifera] Length = 175 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +1 Query: 1 IIFKDGKPLDRFEGAFPADQLIQRIENALKV 93 IIFKDGKP DRFEGA ADQLIQRIE LKV Sbjct: 143 IIFKDGKPYDRFEGALTADQLIQRIETTLKV 173