BLASTX nr result
ID: Ophiopogon23_contig00012056
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00012056 (522 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA58357.1| 40S ribosomal protein S15a [Apostasia shenzhenica] 98 4e-23 gb|PIA38969.1| hypothetical protein AQUCO_02700270v1 [Aquilegia ... 98 4e-23 gb|PIA37994.1| hypothetical protein AQUCO_02900090v1 [Aquilegia ... 98 4e-23 ref|XP_020594848.1| 40S ribosomal protein S15a-like [Phalaenopsi... 98 4e-23 ref|XP_020275290.1| 40S ribosomal protein S15a-like [Asparagus o... 98 4e-23 ref|XP_002279090.1| PREDICTED: 40S ribosomal protein S15a [Vitis... 98 4e-23 ref|XP_020600045.1| 40S ribosomal protein S15a [Phalaenopsis equ... 98 4e-23 ref|XP_014505890.1| 40S ribosomal protein S15a isoform X1 [Vigna... 98 4e-23 ref|XP_017423029.1| PREDICTED: 40S ribosomal protein S15a [Vigna... 98 4e-23 gb|KMZ66359.1| putative 30S ribosomal protein S8 [Zostera marina] 98 4e-23 gb|PKA56373.1| 40S ribosomal protein S15a [Apostasia shenzhenica] 98 1e-22 gb|OTG07567.1| putative ribosomal protein S8 [Helianthus annuus]... 97 1e-22 ref|XP_020551882.1| 40S ribosomal protein S15a-like [Sesamum ind... 97 1e-22 gb|PIN23962.1| 40S ribosomal protein S15/S22 [Handroanthus impet... 97 1e-22 emb|CBI31713.3| unnamed protein product, partial [Vitis vinifera] 98 1e-22 gb|ONK62321.1| uncharacterized protein A4U43_C07F2690 [Asparagus... 98 1e-22 gb|KVI11987.1| Ribosomal protein S8 [Cynara cardunculus var. sco... 97 2e-22 ref|XP_023748791.1| 40S ribosomal protein S15a-like [Lactuca sat... 97 2e-22 gb|PIN24349.1| 40S ribosomal protein S15/S22 [Handroanthus impet... 97 2e-22 gb|PIN24347.1| 40S ribosomal protein S15/S22 [Handroanthus impet... 97 2e-22 >gb|PKA58357.1| 40S ribosomal protein S15a [Apostasia shenzhenica] Length = 130 Score = 98.2 bits (243), Expect = 4e-23 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 85 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|PIA38969.1| hypothetical protein AQUCO_02700270v1 [Aquilegia coerulea] gb|PIA53000.1| hypothetical protein AQUCO_01000696v1 [Aquilegia coerulea] gb|PIA53001.1| hypothetical protein AQUCO_01000696v1 [Aquilegia coerulea] Length = 130 Score = 98.2 bits (243), Expect = 4e-23 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 85 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|PIA37994.1| hypothetical protein AQUCO_02900090v1 [Aquilegia coerulea] gb|PIA37995.1| hypothetical protein AQUCO_02900090v1 [Aquilegia coerulea] Length = 130 Score = 98.2 bits (243), Expect = 4e-23 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 85 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_020594848.1| 40S ribosomal protein S15a-like [Phalaenopsis equestris] Length = 130 Score = 98.2 bits (243), Expect = 4e-23 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 85 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_020275290.1| 40S ribosomal protein S15a-like [Asparagus officinalis] Length = 130 Score = 98.2 bits (243), Expect = 4e-23 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 85 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_002279090.1| PREDICTED: 40S ribosomal protein S15a [Vitis vinifera] ref|XP_002284061.1| PREDICTED: 40S ribosomal protein S15a [Vitis vinifera] ref|XP_010653512.1| PREDICTED: 40S ribosomal protein S15a [Vitis vinifera] emb|CAN65143.1| hypothetical protein VITISV_007037 [Vitis vinifera] emb|CAN76515.1| hypothetical protein VITISV_017255 [Vitis vinifera] emb|CBI32685.3| unnamed protein product, partial [Vitis vinifera] Length = 130 Score = 98.2 bits (243), Expect = 4e-23 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 85 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_020600045.1| 40S ribosomal protein S15a [Phalaenopsis equestris] ref|XP_020680796.1| 40S ribosomal protein S15a [Dendrobium catenatum] ref|XP_020700758.1| 40S ribosomal protein S15a [Dendrobium catenatum] gb|KRY04072.1| 40S ribosomal protein S15a [Trichinella patagoniensis] gb|PKU67241.1| 40S ribosomal protein S15a [Dendrobium catenatum] gb|PKU73990.1| 40S ribosomal protein S15a [Dendrobium catenatum] Length = 130 Score = 98.2 bits (243), Expect = 4e-23 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 85 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_014505890.1| 40S ribosomal protein S15a isoform X1 [Vigna radiata var. radiata] ref|XP_014505891.1| 40S ribosomal protein S15a isoform X1 [Vigna radiata var. radiata] ref|XP_014505892.1| 40S ribosomal protein S15a isoform X1 [Vigna radiata var. radiata] Length = 130 Score = 98.2 bits (243), Expect = 4e-23 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 85 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_017423029.1| PREDICTED: 40S ribosomal protein S15a [Vigna angularis] ref|XP_017423037.1| PREDICTED: 40S ribosomal protein S15a [Vigna angularis] ref|XP_017429254.1| PREDICTED: 40S ribosomal protein S15a [Vigna angularis] ref|XP_020254627.1| 40S ribosomal protein S15a [Asparagus officinalis] ref|XP_020254628.1| 40S ribosomal protein S15a [Asparagus officinalis] ref|XP_020267370.1| 40S ribosomal protein S15a [Asparagus officinalis] gb|KOM33595.1| hypothetical protein LR48_Vigan01g315100 [Vigna angularis] gb|KOM47694.1| hypothetical protein LR48_Vigan07g139800 [Vigna angularis] dbj|BAT76863.1| hypothetical protein VIGAN_01492500 [Vigna angularis var. angularis] dbj|BAT77226.1| hypothetical protein VIGAN_01532300 [Vigna angularis var. angularis] gb|ONK67789.1| uncharacterized protein A4U43_C05F3790 [Asparagus officinalis] gb|ONK78473.1| uncharacterized protein A4U43_C02F19140 [Asparagus officinalis] Length = 130 Score = 98.2 bits (243), Expect = 4e-23 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 85 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|KMZ66359.1| putative 30S ribosomal protein S8 [Zostera marina] Length = 130 Score = 98.2 bits (243), Expect = 4e-23 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 85 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|PKA56373.1| 40S ribosomal protein S15a [Apostasia shenzhenica] Length = 163 Score = 98.2 bits (243), Expect = 1e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 118 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 163 >gb|OTG07567.1| putative ribosomal protein S8 [Helianthus annuus] gb|OTG18906.1| putative ribosomal protein S8 [Helianthus annuus] gb|OTG24217.1| putative ribosomal protein S8 [Helianthus annuus] Length = 117 Score = 96.7 bits (239), Expect = 1e-22 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 +IEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 72 EIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 117 >ref|XP_020551882.1| 40S ribosomal protein S15a-like [Sesamum indicum] Length = 117 Score = 96.7 bits (239), Expect = 1e-22 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 +IEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 72 EIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 117 >gb|PIN23962.1| 40S ribosomal protein S15/S22 [Handroanthus impetiginosus] Length = 119 Score = 96.7 bits (239), Expect = 1e-22 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 +IEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 74 EIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 119 >emb|CBI31713.3| unnamed protein product, partial [Vitis vinifera] Length = 175 Score = 98.2 bits (243), Expect = 1e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 130 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 175 >gb|ONK62321.1| uncharacterized protein A4U43_C07F2690 [Asparagus officinalis] Length = 177 Score = 98.2 bits (243), Expect = 1e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 132 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 177 >gb|KVI11987.1| Ribosomal protein S8 [Cynara cardunculus var. scolymus] Length = 129 Score = 96.7 bits (239), Expect = 2e-22 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 +IEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 84 EIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 129 >ref|XP_023748791.1| 40S ribosomal protein S15a-like [Lactuca sativa] gb|PLY62401.1| hypothetical protein LSAT_5X168601 [Lactuca sativa] Length = 130 Score = 96.7 bits (239), Expect = 2e-22 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 +IEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 85 EIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|PIN24349.1| 40S ribosomal protein S15/S22 [Handroanthus impetiginosus] Length = 130 Score = 96.7 bits (239), Expect = 2e-22 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 +IEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 85 EIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|PIN24347.1| 40S ribosomal protein S15/S22 [Handroanthus impetiginosus] Length = 130 Score = 96.7 bits (239), Expect = 2e-22 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 522 DIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 385 +IEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 85 EIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130