BLASTX nr result
ID: Ophiopogon23_contig00012022
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00012022 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020277154.1| uncharacterized protein LOC109851433 [Aspara... 54 5e-06 >ref|XP_020277154.1| uncharacterized protein LOC109851433 [Asparagus officinalis] gb|ONK59401.1| uncharacterized protein A4U43_C08F6050 [Asparagus officinalis] Length = 206 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -1 Query: 398 ELVHIREFEPSEDGSSDDDFENDGMQRCQCVIQ 300 EL IREFEPSE G+SD++FE++G +RCQCVIQ Sbjct: 174 ELAEIREFEPSELGASDEEFEHEGARRCQCVIQ 206