BLASTX nr result
ID: Ophiopogon23_contig00011910
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00011910 (543 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK63816.1| uncharacterized protein A4U43_C07F19240 [Asparagu... 61 4e-09 ref|XP_020250531.1| transcription factor BIM2-like isoform X1 [A... 57 3e-06 >gb|ONK63816.1| uncharacterized protein A4U43_C07F19240 [Asparagus officinalis] Length = 85 Score = 60.8 bits (146), Expect = 4e-09 Identities = 34/55 (61%), Positives = 35/55 (63%) Frame = -1 Query: 543 SLGKRAKRPXXXXXXXXXXXXXXXSGNRAMEHSMVGSSGEESGQVLKRHKMDNNS 379 SLGKRAKRP GNRAM HSMVGSSGEES Q KRHK+DNNS Sbjct: 33 SLGKRAKRPATTSSAKDPDDPSS--GNRAMGHSMVGSSGEESEQATKRHKLDNNS 85 >ref|XP_020250531.1| transcription factor BIM2-like isoform X1 [Asparagus officinalis] ref|XP_020250532.1| transcription factor BIM2-like isoform X2 [Asparagus officinalis] ref|XP_020250533.1| transcription factor BIM2-like isoform X3 [Asparagus officinalis] gb|ONK55021.1| uncharacterized protein A4U43_UnF8520 [Asparagus officinalis] Length = 299 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/55 (56%), Positives = 33/55 (60%) Frame = -1 Query: 543 SLGKRAKRPXXXXXXXXXXXXXXXSGNRAMEHSMVGSSGEESGQVLKRHKMDNNS 379 SLGKRAKRP SGNRAM SM+GSSGE+ Q KRHKM NNS Sbjct: 245 SLGKRAKRPAATSTSSAKDLDDPSSGNRAMARSMIGSSGEDYEQASKRHKMHNNS 299