BLASTX nr result
ID: Ophiopogon23_contig00011730
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00011730 (372 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247690.1| carbon catabolite repressor protein 4 homolo... 75 3e-13 ref|XP_020247689.1| carbon catabolite repressor protein 4 homolo... 69 3e-11 ref|XP_020247688.1| carbon catabolite repressor protein 4 homolo... 69 3e-11 ref|XP_020523811.1| carbon catabolite repressor protein 4 homolo... 54 7e-06 ref|XP_011624111.1| carbon catabolite repressor protein 4 homolo... 54 8e-06 ref|XP_020523805.1| carbon catabolite repressor protein 4 homolo... 54 8e-06 >ref|XP_020247690.1| carbon catabolite repressor protein 4 homolog 4-like isoform X3 [Asparagus officinalis] Length = 409 Score = 75.1 bits (183), Expect = 3e-13 Identities = 42/56 (75%), Positives = 45/56 (80%) Frame = -2 Query: 170 PSPISNSRVFRCKMSATPSAAAIRPKFVALEDGEDPARSVFDGSRFRVVSYNILAQ 3 PS ISNSRVF+ KMSA P AA I PKFV+LE GEDP S+F SRFRVVSYNILAQ Sbjct: 12 PSYISNSRVFKRKMSAKP-AAPICPKFVSLEVGEDPTTSLFKDSRFRVVSYNILAQ 66 >ref|XP_020247689.1| carbon catabolite repressor protein 4 homolog 4-like isoform X2 [Asparagus officinalis] Length = 411 Score = 69.3 bits (168), Expect = 3e-11 Identities = 42/60 (70%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -2 Query: 170 PSPISNS----RVFRCKMSATPSAAAIRPKFVALEDGEDPARSVFDGSRFRVVSYNILAQ 3 PS ISNS RVF+ KMSA P AA I PKFV+LE GEDP S+F SRFRVVSYNILAQ Sbjct: 12 PSYISNSSSCCRVFKRKMSAKP-AAPICPKFVSLEVGEDPTTSLFKDSRFRVVSYNILAQ 70 >ref|XP_020247688.1| carbon catabolite repressor protein 4 homolog 4-like isoform X1 [Asparagus officinalis] gb|ONK55733.1| uncharacterized protein A4U43_C10F440 [Asparagus officinalis] Length = 413 Score = 69.3 bits (168), Expect = 3e-11 Identities = 42/60 (70%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -2 Query: 170 PSPISNS----RVFRCKMSATPSAAAIRPKFVALEDGEDPARSVFDGSRFRVVSYNILAQ 3 PS ISNS RVF+ KMSA P AA I PKFV+LE GEDP S+F SRFRVVSYNILAQ Sbjct: 12 PSYISNSSSCCRVFKRKMSAKP-AAPICPKFVSLEVGEDPTTSLFKDSRFRVVSYNILAQ 70 >ref|XP_020523811.1| carbon catabolite repressor protein 4 homolog 4 isoform X3 [Amborella trichopoda] Length = 338 Score = 53.9 bits (128), Expect = 7e-06 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = -2 Query: 152 SRVFRCKMSATPSAAAIRPKFVALEDGEDPARSVFDGSRFRVVSYNILAQ 3 S++ RCKMS + I PKF+A+EDG+ R D S FR+VSYNILAQ Sbjct: 18 SKISRCKMSNLSPSPPICPKFIAVEDGKHVLRDARDDSIFRLVSYNILAQ 67 >ref|XP_011624111.1| carbon catabolite repressor protein 4 homolog 4 isoform X2 [Amborella trichopoda] Length = 390 Score = 53.9 bits (128), Expect = 8e-06 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = -2 Query: 155 NSRVFRCKMSATPSAAAIRPKFVALEDGEDPARSVFDGSRFRVVSYNILAQ 3 + R+ RCKMS + I PKF+A+EDG+ R D S FR+VSYNILAQ Sbjct: 15 SQRISRCKMSNLSPSPPICPKFIAVEDGKHVLRDARDDSIFRLVSYNILAQ 65 >ref|XP_020523805.1| carbon catabolite repressor protein 4 homolog 4 isoform X1 [Amborella trichopoda] Length = 392 Score = 53.9 bits (128), Expect = 8e-06 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = -2 Query: 152 SRVFRCKMSATPSAAAIRPKFVALEDGEDPARSVFDGSRFRVVSYNILAQ 3 S++ RCKMS + I PKF+A+EDG+ R D S FR+VSYNILAQ Sbjct: 18 SKISRCKMSNLSPSPPICPKFIAVEDGKHVLRDARDDSIFRLVSYNILAQ 67