BLASTX nr result
ID: Ophiopogon23_contig00011133
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00011133 (492 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247136.1| LOW QUALITY PROTEIN: pullulanase 1, chloropl... 54 5e-09 gb|ONK57269.1| uncharacterized protein A4U43_C10F18340 [Asparagu... 54 5e-09 ref|XP_008775937.1| PREDICTED: pullulanase 1, chloroplastic-like... 48 5e-07 ref|XP_010918919.1| PREDICTED: pullulanase 1, chloroplastic isof... 45 1e-06 ref|XP_010918920.1| PREDICTED: pullulanase 1, chloroplastic isof... 45 1e-06 ref|XP_020703866.1| pullulanase 1, chloroplastic [Dendrobium cat... 48 7e-06 >ref|XP_020247136.1| LOW QUALITY PROTEIN: pullulanase 1, chloroplastic [Asparagus officinalis] Length = 960 Score = 54.3 bits (129), Expect(2) = 5e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 198 VASADNLVKESSYEASSGCSINVPQRTTSVFVEA 299 VAS+D LVKESSYEASSGC +PQRTTSVFVEA Sbjct: 925 VASSDKLVKESSYEASSGC-FTIPQRTTSVFVEA 957 Score = 33.9 bits (76), Expect(2) = 5e-09 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 23 PTEVSVSIPVLKGRMPQLQPVQV 91 PT+ SVS+P L+GR+ QL PVQV Sbjct: 903 PTKTSVSLPSLRGRVLQLHPVQV 925 >gb|ONK57269.1| uncharacterized protein A4U43_C10F18340 [Asparagus officinalis] Length = 947 Score = 54.3 bits (129), Expect(2) = 5e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 198 VASADNLVKESSYEASSGCSINVPQRTTSVFVEA 299 VAS+D LVKESSYEASSGC +PQRTTSVFVEA Sbjct: 912 VASSDKLVKESSYEASSGC-FTIPQRTTSVFVEA 944 Score = 33.9 bits (76), Expect(2) = 5e-09 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 23 PTEVSVSIPVLKGRMPQLQPVQV 91 PT+ SVS+P L+GR+ QL PVQV Sbjct: 890 PTKTSVSLPSLRGRVLQLHPVQV 912 >ref|XP_008775937.1| PREDICTED: pullulanase 1, chloroplastic-like, partial [Phoenix dactylifera] Length = 348 Score = 48.1 bits (113), Expect(2) = 5e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +3 Query: 204 SADNLVKESSYEASSGCSINVPQRTTSVFVE 296 SAD LVKESSYEA+SGC +P+RTTSVFVE Sbjct: 315 SADELVKESSYEAASGC-FTIPRRTTSVFVE 344 Score = 33.1 bits (74), Expect(2) = 5e-07 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +2 Query: 23 PTEVSVSIPVLKGRMPQLQPVQV 91 PT++S+ IP LK RM QL PVQ+ Sbjct: 291 PTKISLQIPALKSRMLQLHPVQL 313 >ref|XP_010918919.1| PREDICTED: pullulanase 1, chloroplastic isoform X1 [Elaeis guineensis] Length = 965 Score = 45.1 bits (105), Expect(2) = 1e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +3 Query: 207 ADNLVKESSYEASSGCSINVPQRTTSVFVE 296 AD LVKESSY+A+SGC +P+RTTSVFVE Sbjct: 933 ADELVKESSYKAASGC-FTIPRRTTSVFVE 961 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = +2 Query: 23 PTEVSVSIPVLKGRMPQLQPVQV 91 PTE+S+ IP LK RM QL PVQ+ Sbjct: 908 PTEISLQIPALKSRMLQLHPVQL 930 >ref|XP_010918920.1| PREDICTED: pullulanase 1, chloroplastic isoform X2 [Elaeis guineensis] Length = 946 Score = 45.1 bits (105), Expect(2) = 1e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +3 Query: 207 ADNLVKESSYEASSGCSINVPQRTTSVFVE 296 AD LVKESSY+A+SGC +P+RTTSVFVE Sbjct: 914 ADELVKESSYKAASGC-FTIPRRTTSVFVE 942 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = +2 Query: 23 PTEVSVSIPVLKGRMPQLQPVQV 91 PTE+S+ IP LK RM QL PVQ+ Sbjct: 889 PTEISLQIPALKSRMLQLHPVQL 911 >ref|XP_020703866.1| pullulanase 1, chloroplastic [Dendrobium catenatum] Length = 966 Score = 48.1 bits (113), Expect(2) = 7e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +3 Query: 195 LVASADNLVKESSYEASSGCSINVPQRTTSVFVE 296 L+ SAD+LVK SSYE+SSGC +PQRTT+VFVE Sbjct: 930 LLDSADSLVKRSSYESSSGC-FKIPQRTTAVFVE 962 Score = 29.3 bits (64), Expect(2) = 7e-06 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +2 Query: 23 PTEVSVSIPVLKGRMPQLQPV 85 PTEVS+ IP LK R QL PV Sbjct: 909 PTEVSMPIPALKRRALQLHPV 929