BLASTX nr result
ID: Ophiopogon23_contig00010908
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00010908 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273570.1| auxin-responsive protein IAA17-like [Asparag... 59 9e-08 >ref|XP_020273570.1| auxin-responsive protein IAA17-like [Asparagus officinalis] gb|ONK79262.1| uncharacterized protein A4U43_C01F4590 [Asparagus officinalis] Length = 272 Score = 58.9 bits (141), Expect = 9e-08 Identities = 32/44 (72%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 235 SIKGFGAGSGSKRGL-DALNGSSPKWVFNGGSGSEVELFSPKKG 363 ++KGFG SGSKRG DAL+GS P W FNGG GSE+ELFSPKKG Sbjct: 61 NLKGFG--SGSKRGFSDALDGS-PNWGFNGGKGSELELFSPKKG 101