BLASTX nr result
ID: Ophiopogon23_contig00008483
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00008483 (848 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250394.1| zinc finger CCCH domain-containing protein 3... 59 4e-06 >ref|XP_020250394.1| zinc finger CCCH domain-containing protein 32-like, partial [Asparagus officinalis] Length = 653 Score = 58.9 bits (141), Expect = 4e-06 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = +3 Query: 102 NCLNPKCPFRHPLLDSLFGAAG*DLPLPQVLLIASKKILMAHTPAYNL 245 NCLNPKC FRHP LD L G +P L +ASK I MA TPAYN+ Sbjct: 51 NCLNPKCAFRHPPLDGLLVPPGSGPAIPPTLAVASKPIPMAQTPAYNM 98