BLASTX nr result
ID: Ophiopogon23_contig00008168
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00008168 (1406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020104091.1| fasciclin-like arabinogalactan protein 21 [A... 62 2e-06 >ref|XP_020104091.1| fasciclin-like arabinogalactan protein 21 [Ananas comosus] Length = 429 Score = 61.6 bits (148), Expect = 2e-06 Identities = 40/86 (46%), Positives = 51/86 (59%), Gaps = 4/86 (4%) Frame = +2 Query: 620 LVATLDPFPFLDTAASSYPLH-YSLSSRIAVNPPQQAQPGTP---LASILSNLGFQELSM 787 LVA F +AAS+Y L ++ S PPQ A+ LA ILSNLGFQEL+M Sbjct: 8 LVALALLFSATSSAASAYALPPFNQSPSPPPPPPQSAEEAHEVLLLAPILSNLGFQELAM 67 Query: 788 GFPFVASILPSPWSSPVTMLAPSDDS 865 P ++S + S WS P+T+ APSDDS Sbjct: 68 AVPALSSPVLSTWSGPLTLFAPSDDS 93