BLASTX nr result
ID: Ophiopogon23_contig00007677
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00007677 (887 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020274924.1| probable inactive 2-oxoglutarate-dependent d... 50 1e-09 >ref|XP_020274924.1| probable inactive 2-oxoglutarate-dependent dioxygenase AOP2 [Asparagus officinalis] gb|ONK79394.1| uncharacterized protein A4U43_C01F5910 [Asparagus officinalis] Length = 323 Score = 50.1 bits (118), Expect(2) = 1e-09 Identities = 22/39 (56%), Positives = 28/39 (71%) Frame = -2 Query: 679 VWTNGRFQPSLLRVKMIPNMKRYSTHFGI*SSDDYMIKP 563 VWTNG+FQP + RV MI + KRYS F SDDY+++P Sbjct: 236 VWTNGKFQPPIHRVNMIGDEKRYSVLFATRPSDDYLLEP 274 Score = 41.6 bits (96), Expect(2) = 1e-09 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -3 Query: 528 F*AFNYKEYIKFRYSEEWKKCKETLEAFC 442 F YK+YI FRYSEE +KCK LE +C Sbjct: 287 FKPLKYKDYITFRYSEEGRKCKNPLEGYC 315