BLASTX nr result
ID: Ophiopogon23_contig00007433
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00007433 (945 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008466937.1| PREDICTED: glycogen synthase kinase-3 homolo... 56 4e-06 gb|PIA60862.1| hypothetical protein AQUCO_00300407v1 [Aquilegia ... 58 5e-06 ref|XP_008672929.1| uncharacterized protein LOC100283734 isoform... 59 7e-06 >ref|XP_008466937.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Cucumis melo] Length = 146 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = -2 Query: 938 FLYQVFRVLAYIHGRVGVCHRDIKPQNLLACLFEISSTLNF 816 + YQ+ R L+YIH +GVCHRDIKPQNLL + +S L F Sbjct: 104 YFYQICRALSYIHNSIGVCHRDIKPQNLLVSVHSVSGVLYF 144 >gb|PIA60862.1| hypothetical protein AQUCO_00300407v1 [Aquilegia coerulea] Length = 230 Score = 57.8 bits (138), Expect = 5e-06 Identities = 27/41 (65%), Positives = 30/41 (73%), Gaps = 5/41 (12%) Frame = -2 Query: 938 FLYQVFRVLAYIHGRVGVCHRDIKPQNLLAC-----LFEIS 831 + YQ+ R LAYIHG +GVCHRDIKPQNLL C LF IS Sbjct: 177 YTYQICRALAYIHGSIGVCHRDIKPQNLLVCRNVFVLFAIS 217 >ref|XP_008672929.1| uncharacterized protein LOC100283734 isoform X1 [Zea mays] Length = 438 Score = 58.5 bits (140), Expect = 7e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -2 Query: 938 FLYQVFRVLAYIHGRVGVCHRDIKPQNLLAC 846 ++YQ+ R LAYIHG +GVCHRDIKPQNLL C Sbjct: 176 YMYQICRALAYIHGTIGVCHRDIKPQNLLVC 206