BLASTX nr result
ID: Ophiopogon23_contig00007071
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00007071 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257222.1| probable xyloglucan endotransglucosylase/hyd... 88 6e-18 ref|XP_020704239.1| probable xyloglucan endotransglucosylase/hyd... 75 4e-13 gb|PKA65655.1| putative xyloglucan endotransglucosylase/hydrolas... 73 2e-12 ref|XP_010911228.2| PREDICTED: probable xyloglucan endotransgluc... 71 1e-11 ref|XP_008795338.1| PREDICTED: probable xyloglucan endotransgluc... 70 2e-11 gb|ABC60347.1| putative xyloglucan transferase, partial [Musa ac... 67 2e-11 ref|XP_008798384.1| PREDICTED: probable xyloglucan endotransgluc... 68 9e-11 ref|XP_009380067.1| PREDICTED: probable xyloglucan endotransgluc... 68 1e-10 ref|XP_009414090.1| PREDICTED: probable xyloglucan endotransgluc... 67 2e-10 ref|XP_020272726.1| probable xyloglucan endotransglucosylase/hyd... 67 3e-10 ref|XP_009777457.1| PREDICTED: probable xyloglucan endotransgluc... 65 5e-10 gb|PHT47945.1| putative xyloglucan endotransglucosylase/hydrolas... 65 9e-10 gb|PHU17390.1| putative xyloglucan endotransglucosylase/hydrolas... 64 1e-09 ref|XP_023550611.1| probable xyloglucan endotransglucosylase/hyd... 65 2e-09 ref|XP_009621345.1| PREDICTED: probable xyloglucan endotransgluc... 65 2e-09 gb|PHT81319.1| putative xyloglucan endotransglucosylase/hydrolas... 64 2e-09 ref|XP_022939606.1| probable xyloglucan endotransglucosylase/hyd... 64 2e-09 ref|XP_019225541.1| PREDICTED: probable xyloglucan endotransgluc... 64 2e-09 ref|XP_016572584.1| PREDICTED: probable xyloglucan endotransgluc... 64 2e-09 ref|XP_009777519.1| PREDICTED: probable xyloglucan endotransgluc... 64 2e-09 >ref|XP_020257222.1| probable xyloglucan endotransglucosylase/hydrolase protein 28 [Asparagus officinalis] gb|ONK75361.1| uncharacterized protein A4U43_C03F16030 [Asparagus officinalis] Length = 327 Score = 87.8 bits (216), Expect = 6e-18 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +1 Query: 1 DRYSSITISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREAK 150 DRY+S+TIS +QR AM + RKKY+TYSYCYDRERYPT TPECS+D REAK Sbjct: 250 DRYNSVTISYQQRLAMNDFRKKYVTYSYCYDRERYPTRTPECSVDLREAK 299 >ref|XP_020704239.1| probable xyloglucan endotransglucosylase/hydrolase protein 28 [Dendrobium catenatum] gb|PKU79888.1| putative xyloglucan endotransglucosylase/hydrolase protein 28 [Dendrobium catenatum] Length = 340 Score = 74.7 bits (182), Expect = 4e-13 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = +1 Query: 7 YSSITISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREAKQ 153 Y SIT + +Q AM++LR+K++TYSYCYD +RYPTP PECS+D REA+Q Sbjct: 261 YDSITATSDQLSAMKKLRRKHLTYSYCYDGDRYPTPPPECSVDPREAEQ 309 >gb|PKA65655.1| putative xyloglucan endotransglucosylase/hydrolase protein 28 [Apostasia shenzhenica] Length = 332 Score = 72.8 bits (177), Expect = 2e-12 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = +1 Query: 7 YSSITISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREA 147 Y S+ ISPEQR M++LR+K++TYSYCYDR+RYP PECS DA EA Sbjct: 255 YDSVGISPEQRSLMQKLRRKHLTYSYCYDRQRYPAAPPECSPDASEA 301 >ref|XP_010911228.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 27 [Elaeis guineensis] Length = 330 Score = 70.9 bits (172), Expect = 1e-11 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 2/53 (3%) Frame = +1 Query: 1 DRYSSITISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECS--IDAREAKQ 153 D YS+IT+S +QR AME RKKY+TYSYCYDR RY P PECS ++AR+ ++ Sbjct: 252 DLYSTITVSADQRMAMERFRKKYMTYSYCYDRVRYSVPLPECSTGLEARQFQE 304 >ref|XP_008795338.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 28 [Phoenix dactylifera] Length = 337 Score = 70.1 bits (170), Expect = 2e-11 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = +1 Query: 4 RYSSITISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREAKQ 153 RY S T+S EQR ME R+K++TY YCYDR RYP P PEC+ID REA++ Sbjct: 256 RYDSATMSSEQRAQMESFRRKHVTYFYCYDRNRYPNPPPECNID-REARR 304 >gb|ABC60347.1| putative xyloglucan transferase, partial [Musa acuminata AAA Group] Length = 136 Score = 67.0 bits (162), Expect = 2e-11 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = +1 Query: 7 YSSITISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSI 132 Y +IT+S +QR AM++ RKK+ITYSYC+DR RYPTP PEC++ Sbjct: 61 YDTITMSADQRTAMDKFRKKHITYSYCHDRVRYPTPPPECNL 102 >ref|XP_008798384.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 27 [Phoenix dactylifera] Length = 335 Score = 68.2 bits (165), Expect = 9e-11 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +1 Query: 1 DRYSSITISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREAKQ 153 D Y +ITIS +QR AME RKK++TYSYCYDR RY TP PECS EA+Q Sbjct: 257 DLYDTITISTDQRLAMERFRKKHMTYSYCYDRIRYSTPLPECSA-GPEARQ 306 >ref|XP_009380067.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 28 [Musa acuminata subsp. malaccensis] Length = 342 Score = 68.2 bits (165), Expect = 1e-10 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +1 Query: 7 YSSITISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSI 132 Y SIT+S +QR AM++ RKK+ITYSYC+DR RYPTP PEC++ Sbjct: 267 YDSITMSADQRTAMDKFRKKHITYSYCHDRVRYPTPPPECNL 308 >ref|XP_009414090.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 28 [Musa acuminata subsp. malaccensis] Length = 343 Score = 67.4 bits (163), Expect = 2e-10 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +1 Query: 7 YSSITISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREAKQ 153 Y S T+SPEQR M+ R++++TY YCYDR+RYPTP EC ID E +Q Sbjct: 262 YGSSTMSPEQRAQMDGFRRRHMTYYYCYDRDRYPTPPAECKIDQIETRQ 310 >ref|XP_020272726.1| probable xyloglucan endotransglucosylase/hydrolase protein 28 [Asparagus officinalis] gb|ONK65331.1| uncharacterized protein A4U43_C07F36020 [Asparagus officinalis] Length = 309 Score = 66.6 bits (161), Expect = 3e-10 Identities = 30/42 (71%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +1 Query: 4 RYSSITISPEQRR-AMEELRKKYITYSYCYDRERYPTPTPEC 126 RYSSI IS + R AM+ RKKY+TYSYCYDRERYP P PEC Sbjct: 251 RYSSIKISDDDERLAMQGFRKKYVTYSYCYDRERYPVPVPEC 292 >ref|XP_009777457.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 27 [Nicotiana sylvestris] Length = 202 Score = 64.7 bits (156), Expect = 5e-10 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +1 Query: 19 TISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREA 147 +ISP+QRR ME RKKY+ YSYCYDR RY P EC ID +EA Sbjct: 120 SISPDQRRKMESFRKKYLQYSYCYDRTRYNVPLSECVIDPKEA 162 >gb|PHT47945.1| putative xyloglucan endotransglucosylase/hydrolase protein 28 [Capsicum baccatum] Length = 330 Score = 65.5 bits (158), Expect = 9e-10 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +1 Query: 22 ISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREA 147 ISP+QRR ME LRKK++ YSYCYDR RY P EC+ID +EA Sbjct: 254 ISPDQRRKMESLRKKHLQYSYCYDRTRYKVPLSECAIDPKEA 295 >gb|PHU17390.1| putative xyloglucan endotransglucosylase/hydrolase protein 28 [Capsicum chinense] Length = 236 Score = 64.3 bits (155), Expect = 1e-09 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +1 Query: 22 ISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREA 147 ISP+QRR ME LRKK++ YSYCYDR RY P EC ID +EA Sbjct: 160 ISPDQRRKMESLRKKHLQYSYCYDRTRYKVPLSECVIDPKEA 201 >ref|XP_023550611.1| probable xyloglucan endotransglucosylase/hydrolase protein 28 [Cucurbita pepo subsp. pepo] Length = 330 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +1 Query: 22 ISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREAKQ 153 I+P QR ME LRKK++TYSYCYDR RY +P PEC I+ EAK+ Sbjct: 256 ITPSQRAKMESLRKKHLTYSYCYDRIRYKSPPPECVINPEEAKR 299 >ref|XP_009621345.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 27 [Nicotiana tomentosiformis] ref|XP_016496275.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 27 [Nicotiana tabacum] Length = 330 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +1 Query: 19 TISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREA 147 +ISP+QRR ME RKKY+ YSYCYDR RY P EC ID +EA Sbjct: 253 SISPDQRRKMESFRKKYLQYSYCYDRTRYNVPLSECVIDPKEA 295 >gb|PHT81319.1| putative xyloglucan endotransglucosylase/hydrolase protein 28 [Capsicum annuum] Length = 287 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +1 Query: 22 ISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREA 147 ISP+QRR ME LRKK++ YSYCYDR RY P EC ID +EA Sbjct: 211 ISPDQRRKMESLRKKHLQYSYCYDRTRYKVPLSECVIDPKEA 252 >ref|XP_022939606.1| probable xyloglucan endotransglucosylase/hydrolase protein 28 [Cucurbita moschata] Length = 330 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +1 Query: 22 ISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREAKQ 153 I+P QR ME LRKK++TYSYCYDR RY P PEC I+ EAK+ Sbjct: 256 ITPSQRAKMESLRKKHLTYSYCYDRIRYKAPPPECVINPEEAKR 299 >ref|XP_019225541.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 27 [Nicotiana attenuata] gb|OIT32593.1| putative xyloglucan endotransglucosylasehydrolase protein 28 [Nicotiana attenuata] Length = 330 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +1 Query: 22 ISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREA 147 ISP+QRR ME RKKY+ YSYCYDR RY P EC ID +EA Sbjct: 254 ISPDQRRKMESFRKKYLQYSYCYDRTRYNVPLSECVIDRKEA 295 >ref|XP_016572584.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 28 [Capsicum annuum] Length = 330 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +1 Query: 22 ISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREA 147 ISP+QRR ME LRKK++ YSYCYDR RY P EC ID +EA Sbjct: 254 ISPDQRRKMESLRKKHLQYSYCYDRTRYKVPLSECVIDPKEA 295 >ref|XP_009777519.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 27 [Nicotiana sylvestris] ref|XP_016465811.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 27 [Nicotiana tabacum] Length = 330 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +1 Query: 22 ISPEQRRAMEELRKKYITYSYCYDRERYPTPTPECSIDAREA 147 ISP+QRR ME RKKY+ YSYCYDR RY P EC ID +EA Sbjct: 254 ISPDQRRKMESFRKKYLQYSYCYDRTRYNVPLSECVIDPKEA 295