BLASTX nr result
ID: Ophiopogon23_contig00006953
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00006953 (488 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK72180.1| uncharacterized protein A4U43_C04F16610 [Asparagu... 111 2e-27 ref|XP_020261255.1| exosome complex exonuclease RRP46 homolog [A... 111 3e-27 ref|XP_008786334.1| PREDICTED: exosome complex exonuclease RRP46... 109 2e-26 gb|OVA08571.1| Exoribonuclease [Macleaya cordata] 107 1e-25 ref|XP_010933463.1| PREDICTED: exosome complex exonuclease RRP46... 107 2e-25 gb|OAP03536.1| hypothetical protein AXX17_AT3G40100 [Arabidopsis... 103 2e-25 ref|XP_009396849.1| PREDICTED: exosome complex exonuclease RRP46... 106 3e-25 gb|OMO92124.1| hypothetical protein COLO4_17864 [Corchorus olito... 101 3e-25 ref|XP_021665263.1| exosome complex exonuclease RRP46 homolog is... 106 3e-25 ref|XP_021665262.1| exosome complex exonuclease RRP46 homolog is... 106 4e-25 gb|ESQ37379.1| hypothetical protein EUTSA_v10002689mg [Eutrema s... 103 9e-25 ref|XP_010244440.1| PREDICTED: exosome complex exonuclease RRP46... 105 1e-24 ref|XP_021594759.1| exosome complex exonuclease RRP46 homolog [M... 104 1e-24 ref|XP_010503239.1| PREDICTED: exosome complex exonuclease RRP46... 104 1e-24 ref|XP_006291764.1| exosome complex exonuclease RRP46 homolog [C... 103 4e-24 ref|XP_024009503.1| exosome complex exonuclease RRP46 homolog [E... 103 5e-24 ref|XP_024017397.1| exosome complex exonuclease RRP46 homolog [M... 103 5e-24 ref|XP_013703744.1| exosome complex exonuclease RRP46 homolog [B... 103 5e-24 ref|NP_190207.1| Ribosomal protein S5 domain 2-like superfamily ... 103 5e-24 gb|PON94640.1| Guanosine pentaphosphate synthetase I/polyribonuc... 103 5e-24 >gb|ONK72180.1| uncharacterized protein A4U43_C04F16610 [Asparagus officinalis] Length = 223 Score = 111 bits (278), Expect = 2e-27 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M+VDRLDGR PNQLRPLACSRN+LHRAHGSARWSQGDT VL+AVYGPKAGTRKGEN Sbjct: 1 MEVDRLDGRNPNQLRPLACSRNVLHRAHGSARWSQGDTIVLAAVYGPKAGTRKGEN 56 >ref|XP_020261255.1| exosome complex exonuclease RRP46 homolog [Asparagus officinalis] Length = 238 Score = 111 bits (278), Expect = 3e-27 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M+VDRLDGR PNQLRPLACSRN+LHRAHGSARWSQGDT VL+AVYGPKAGTRKGEN Sbjct: 1 MEVDRLDGRNPNQLRPLACSRNVLHRAHGSARWSQGDTIVLAAVYGPKAGTRKGEN 56 >ref|XP_008786334.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Phoenix dactylifera] Length = 240 Score = 109 bits (272), Expect = 2e-26 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M+V R DGRTPNQLRPLACSRNLLHRAHGSARWSQGDT VL+AVYGPKAGTRKGEN Sbjct: 1 MEVVRADGRTPNQLRPLACSRNLLHRAHGSARWSQGDTIVLAAVYGPKAGTRKGEN 56 >gb|OVA08571.1| Exoribonuclease [Macleaya cordata] Length = 236 Score = 107 bits (267), Expect = 1e-25 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M+VDR+DGRTPNQLRPLACSRNLL+RAHGSARWSQGDT VL+AVYGPKAGT+K EN Sbjct: 1 MEVDRVDGRTPNQLRPLACSRNLLNRAHGSARWSQGDTIVLAAVYGPKAGTKKNEN 56 >ref|XP_010933463.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Elaeis guineensis] ref|XP_010933464.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Elaeis guineensis] Length = 240 Score = 107 bits (266), Expect = 2e-25 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M+V R DGRTPNQLRPLACSRNLLHRAHGSARWSQGDT VL+AVYGPKAG RKGEN Sbjct: 1 MEVVRADGRTPNQLRPLACSRNLLHRAHGSARWSQGDTIVLAAVYGPKAGIRKGEN 56 >gb|OAP03536.1| hypothetical protein AXX17_AT3G40100 [Arabidopsis thaliana] Length = 118 Score = 103 bits (256), Expect = 2e-25 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M++DR DGRTPNQLRPLACSRN+LHR HGSA WSQGDT VL+AVYGPKAGT+K EN Sbjct: 1 MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNEN 56 >ref|XP_009396849.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Musa acuminata subsp. malaccensis] ref|XP_018679830.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Musa acuminata subsp. malaccensis] Length = 246 Score = 106 bits (265), Expect = 3e-25 Identities = 49/58 (84%), Positives = 53/58 (91%) Frame = +1 Query: 313 GIMDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 G M VDR DGR+ NQLRPLACSRN+LHRAHGSARWSQGDT VL+AVYGPKAGT+KGEN Sbjct: 2 GAMTVDRADGRSVNQLRPLACSRNILHRAHGSARWSQGDTIVLAAVYGPKAGTKKGEN 59 >gb|OMO92124.1| hypothetical protein COLO4_17864 [Corchorus olitorius] Length = 75 Score = 101 bits (252), Expect = 3e-25 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M+V+R DGRT NQLRPLACSRN+LHRAHGSA WSQGDT VL+AVYGPKAGTRK EN Sbjct: 1 MEVNREDGRTQNQLRPLACSRNILHRAHGSASWSQGDTKVLAAVYGPKAGTRKNEN 56 >ref|XP_021665263.1| exosome complex exonuclease RRP46 homolog isoform X2 [Hevea brasiliensis] Length = 244 Score = 106 bits (264), Expect = 3e-25 Identities = 47/57 (82%), Positives = 53/57 (92%) Frame = +1 Query: 316 IMDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 +M++DR DGRTPNQLRPLACSRN+LHRAHGSA WSQGDT VL+AVYGPKAGT+K EN Sbjct: 1 MMEIDRADGRTPNQLRPLACSRNILHRAHGSASWSQGDTKVLAAVYGPKAGTKKNEN 57 >ref|XP_021665262.1| exosome complex exonuclease RRP46 homolog isoform X1 [Hevea brasiliensis] Length = 245 Score = 106 bits (264), Expect = 4e-25 Identities = 47/57 (82%), Positives = 53/57 (92%) Frame = +1 Query: 316 IMDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 +M++DR DGRTPNQLRPLACSRN+LHRAHGSA WSQGDT VL+AVYGPKAGT+K EN Sbjct: 1 MMEIDRADGRTPNQLRPLACSRNILHRAHGSASWSQGDTKVLAAVYGPKAGTKKNEN 57 >gb|ESQ37379.1| hypothetical protein EUTSA_v10002689mg [Eutrema salsugineum] Length = 168 Score = 103 bits (256), Expect = 9e-25 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M++DR DGRTPNQLRPLACSRN+LHR HGSA WSQGDT VL+AVYGPKAGT+K EN Sbjct: 1 MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNEN 56 >ref|XP_010244440.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Nelumbo nucifera] Length = 243 Score = 105 bits (261), Expect = 1e-24 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M+VDR+DGRT NQLRPLACSRNLL+RAHGSARWSQGDT VL+AVYGPKAGTRK EN Sbjct: 1 MEVDRVDGRTRNQLRPLACSRNLLNRAHGSARWSQGDTIVLAAVYGPKAGTRKNEN 56 >ref|XP_021594759.1| exosome complex exonuclease RRP46 homolog [Manihot esculenta] gb|OAY60375.1| hypothetical protein MANES_01G107300 [Manihot esculenta] Length = 242 Score = 104 bits (260), Expect = 1e-24 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M++DR DGRTPNQLRPLACSRN+LHRAHGSA WSQGDT VL+AVYGPKAGT+K EN Sbjct: 1 MEIDRDDGRTPNQLRPLACSRNILHRAHGSASWSQGDTKVLAAVYGPKAGTKKNEN 56 >ref|XP_010503239.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Camelina sativa] Length = 242 Score = 104 bits (260), Expect = 1e-24 Identities = 46/56 (82%), Positives = 52/56 (92%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M++DR+DGRTPNQLRPLACSRN+LHR HGSA WSQGDT VL+AVYGPKAGT+K EN Sbjct: 1 MEIDRVDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNEN 56 >ref|XP_006291764.1| exosome complex exonuclease RRP46 homolog [Capsella rubella] ref|XP_023638493.1| exosome complex exonuclease RRP46 homolog [Capsella rubella] gb|EOA24662.1| hypothetical protein CARUB_v10017935mg [Capsella rubella] Length = 242 Score = 103 bits (257), Expect = 4e-24 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M+VDR DGRTPNQLRPLACSRN+LHR HGSA WSQGDT VL+AVYGPKAGT+K EN Sbjct: 1 MEVDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNEN 56 >ref|XP_024009503.1| exosome complex exonuclease RRP46 homolog [Eutrema salsugineum] Length = 237 Score = 103 bits (256), Expect = 5e-24 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M++DR DGRTPNQLRPLACSRN+LHR HGSA WSQGDT VL+AVYGPKAGT+K EN Sbjct: 1 MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNEN 56 >ref|XP_024017397.1| exosome complex exonuclease RRP46 homolog [Morus notabilis] Length = 237 Score = 103 bits (256), Expect = 5e-24 Identities = 46/56 (82%), Positives = 53/56 (94%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M++DR+DGRTPNQLRPLACSRN+L+RAHGSA WSQGDT VL+AVYGPKAGT+K EN Sbjct: 1 MEIDRIDGRTPNQLRPLACSRNVLNRAHGSASWSQGDTKVLAAVYGPKAGTKKHEN 56 >ref|XP_013703744.1| exosome complex exonuclease RRP46 homolog [Brassica napus] Length = 238 Score = 103 bits (256), Expect = 5e-24 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M++DR DGRTPNQLRPLACSRN+LHR HGSA WSQGDT VL+AVYGPK+GTRK EN Sbjct: 1 MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKSGTRKNEN 56 >ref|NP_190207.1| Ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis thaliana] ref|NP_001030817.1| Ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis thaliana] ref|NP_001030818.1| Ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis thaliana] ref|NP_001030819.1| Ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis thaliana] ref|NP_001078250.1| Ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis thaliana] ref|NP_001190019.1| Ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis thaliana] ref|NP_001325681.1| Ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis thaliana] sp|Q9LX74.1|EXOS5_ARATH RecName: Full=Exosome complex exonuclease RRP46 homolog; AltName: Full=Exosome component 5; AltName: Full=Ribosomal RNA-processing protein 46 emb|CAB90948.1| putative protein [Arabidopsis thaliana] gb|AAO24557.1| At3g46210 [Arabidopsis thaliana] dbj|BAF00127.1| hypothetical protein [Arabidopsis thaliana] dbj|BAH19939.1| AT3G46210 [Arabidopsis thaliana] dbj|BAH20201.1| AT3G46210 [Arabidopsis thaliana] gb|AEE78129.1| Ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis thaliana] gb|AEE78130.1| Ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis thaliana] gb|AEE78131.1| Ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis thaliana] gb|AEE78132.1| Ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis thaliana] gb|AEE78133.1| Ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis thaliana] gb|AEE78134.1| Ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis thaliana] gb|ANM63606.1| Ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis thaliana] Length = 239 Score = 103 bits (256), Expect = 5e-24 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M++DR DGRTPNQLRPLACSRN+LHR HGSA WSQGDT VL+AVYGPKAGT+K EN Sbjct: 1 MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNEN 56 >gb|PON94640.1| Guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase [Trema orientalis] Length = 273 Score = 103 bits (258), Expect = 5e-24 Identities = 46/56 (82%), Positives = 53/56 (94%) Frame = +1 Query: 319 MDVDRLDGRTPNQLRPLACSRNLLHRAHGSARWSQGDTTVLSAVYGPKAGTRKGEN 486 M++DR+DGRTPNQLRPLACSRN+L+RAHGSA WSQGDT VL+AVYGPKAGT+K EN Sbjct: 1 MEIDRIDGRTPNQLRPLACSRNVLNRAHGSASWSQGDTKVLAAVYGPKAGTKKNEN 56